DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28d1 and Cyp12e1

DIOPT Version :9

Sequence 1:NP_608912.1 Gene:Cyp28d1 / 33749 FlyBaseID:FBgn0031689 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_650003.4 Gene:Cyp12e1 / 41272 FlyBaseID:FBgn0037817 Length:522 Species:Drosophila melanogaster


Alignment Length:465 Identity:108/465 - (23%)
Similarity:167/465 - (35%) Gaps:106/465 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 YAHKIYVSD-FRSFHDNEMAKFTDSKTDPILANNPFVLTGEAWKERRAEVTPGLSANRVKAAYPV 154
            |.....|.| |:..|..|:....|..|.   .|.|      ||.:.|..|.|.|...|....|..
  Fly   110 YRRSFEVMDYFKRVHRREVFDGYDGLTS---GNGP------AWGKMRTAVNPILLQPRNAKLYMT 165

  Fly   155 SL-RVCKKFVEYIR--RQSL---MAPAQGLNAKDLCLCYTTEVISDCVLG-ISAQSFTDNPTPMV 212
            :| :|..:|:|.||  |..:   |.....::.:.|.:.....|..:..|| :..|....:...:|
  Fly   166 NLVQVSDEFLERIRIIRDPVTQEMPDDFAVDIRHLVIESICSVALNTHLGLLGEQRNNKDIQKLV 230

  Fly   213 GMTKRVFEQSFGFIFYTVVANLWP--PITKFYSVSLFAKDVAAFFYDLMQKCIQVRRESPAAQQR 275
            ...:.|.|..|..   .::...|.  |:..|..:......:..|.|..:...:: |.|..|....
  Fly   231 LALQDVVELGFQL---DIMPAFWKYLPMPNFKKLMRSLDTITDFCYFHIGNALK-RIEEDAKAGT 291

  Fly   276 DDFLNYMLQLQEKKGLNAAELTSHT-----MTFLTDGFETTAQVLTHTLLFLARNPKEQMKLREE 335
            .:.:.....|.||    .|.....|     |..|..|.:.|...|...|..|:::|.:|.:|.||
  Fly   292 LNEIGLETSLLEK----LARFDRQTAVIIAMDLLFAGADPTLVTLGGILFSLSKSPDKQARLLEE 352

  Fly   336 I------GTAELTFEQISELPFTEACIHETLRIF------------SPVLAARKVVTEPCELTNK 382
            |      ..:.||.|.:..||:..|||.|.:|::            ..||:..:||...      
  Fly   353 IRGILPNKDSSLTIENMRNLPYLRACIKEGIRMYPIGPGTLRRMPHDVVLSGYRVVAGT------ 411

  Fly   383 NGVSVKLRPGDVVIIPVNALHHDPQYYEEPQSFKPERFLNINGGAKKYRDQG------------L 435
                      ||.|.....:.:..|:..:.:.|.|||:|         ||:.            :
  Fly   412 ----------DVGIAANYQMANMEQFVPKVREFIPERWL---------RDESNSHLVGETATPFM 457

  Fly   436 FFGFGDGPRICPGMRFSLTQIKAALVEIVRNFDIKVNPKTRKDNEIDDTYFMPALKGGVWLD--- 497
            :..||.|||.|.|.|.....::.|:..:||||.|..      |..|::     |.|...::.   
  Fly   458 YLPFGFGPRSCAGKRIVDMMLEIAISRLVRNFKIGF------DYPIEN-----AFKAQFFVQPNI 511

  Fly   498 -----FVERN 502
                 |:|||
  Fly   512 PFKFKFIERN 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28d1NP_608912.1 p450 35..477 CDD:278495 100/430 (23%)
Cyp12e1NP_650003.4 p450 63..517 CDD:299894 104/459 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.