DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28d1 and Cyp12b2

DIOPT Version :9

Sequence 1:NP_608912.1 Gene:Cyp28d1 / 33749 FlyBaseID:FBgn0031689 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_611370.2 Gene:Cyp12b2 / 37163 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster


Alignment Length:459 Identity:112/459 - (24%)
Similarity:186/459 - (40%) Gaps:76/459 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VGSFPSVFTQKRNVVYDIDEIYEQYKNTDSIVGVFQTRIPQLMVTTPEYAHKIYVSDFRSFHDNE 107
            :|...:|||      |:.|:....|:|.    ||:..||.   :.:..|        :|..|..:
  Fly   100 MGKPNAVFT------YNPDDFEMTYRNE----GVWPIRIG---LESLNY--------YRKIHRPD 143

  Fly   108 MAKFTDSKTDPILANNPFVLTGEAWKERRAEVTPGL-SANRVKAAYPVSLRVCKKFVEYIRRQSL 171
            :.|....     ||::    .|:.|.:.|.:|.|.| ....|:...|...::.|:|::.:..|  
  Fly   144 VFKGVGG-----LASD----QGQEWADIRNKVNPVLMKVQNVRQNLPQLDQISKEFIDKLETQ-- 197

  Fly   172 MAPAQGLNAKDL---CLCYTTEVISDCVLGISAQSFTDNPTPMVGMTKRVFEQSFGFIFYTVVAN 233
            ..|.......|.   ...:..|.||...|.......:|||.|   ...|:.:....|..|:...:
  Fly   198 RNPETHTLTTDFHNQLKMWAFESISFVALNTRMGLLSDNPDP---NADRLAKHMRDFFNYSFQFD 259

  Fly   234 LWPPITKFYSVSLFAKDVAAF--FYDLMQKCIQVRRESPAAQQRDD-----FLNYMLQLQEKKGL 291
            :.|.|..||..:.|.|.:..:  ..|:....|:....  ...:.||     .|..:|:..:|..:
  Fly   260 VQPSIWTFYKTAGFKKFLKTYDNITDITSNYIETAMR--GFGKNDDGKTKCVLEQLLEHNKKVAV 322

  Fly   292 NAAELTSHTMTFLTDGFETTAQVLTHTLLFLARNPKEQMKLREEI------GTAELTFEQISELP 350
                  :..|..|..|.:||:......|..|||||.:|.|||.|:      ....||.:....:|
  Fly   323 ------TMVMDMLMAGIDTTSSACLTILYHLARNPSKQEKLRRELLRILPTTKDSLTDQNTKNMP 381

  Fly   351 FTEACIHETLRIFSPVLAARKVVTEPCELTNKNGV--SVKLRPGDVVIIPVNALHHDPQYYEEPQ 413
            :..|||.|.|||.|       :......:|.|:.|  ..::..|..|::.|..|.:|.:|:.:..
  Fly   382 YLRACIKEGLRITS-------ITPGNFRITPKDLVLSGYQVPRGTGVLMGVLELSNDDKYFAQSS 439

  Fly   414 SFKPERFLNINGG-------AKKYRDQGLFFGFGDGPRICPGMRFSLTQIKAALVEIVRNFDIKV 471
            .|.|||:|..:..       |.:.|:..::..||.|||.|.|.|.:..:|:..||.::|::.:..
  Fly   440 EFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVSW 504

  Fly   472 NPKT 475
            .|:|
  Fly   505 LPET 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28d1NP_608912.1 p450 35..477 CDD:278495 112/459 (24%)
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 112/459 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.