DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28d1 and Cyp6a14

DIOPT Version :9

Sequence 1:NP_608912.1 Gene:Cyp28d1 / 33749 FlyBaseID:FBgn0031689 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001286199.1 Gene:Cyp6a14 / 35835 FlyBaseID:FBgn0033302 Length:509 Species:Drosophila melanogaster


Alignment Length:529 Identity:145/529 - (27%)
Similarity:243/529 - (45%) Gaps:57/529 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LFVIA---AILALIYVFLTWNFSYWKKRGIPTAKSWPFVGSFPSVFTQKRNVVYDIDE-IYEQYK 68
            ||.||   .:|.|.|......|||||::|:|.....|.||:...:.  |:....||:: ||:::|
  Fly     2 LFTIALVGVVLGLAYSLHIKIFSYWKRKGVPHETPLPIVGNMRGIV--KKYHFRDINQRIYKKFK 64

  Fly    69 NTDSIVGVFQTRIPQLMVTTPEYAHKIYVSDFRSFHDNEMAKFTDSKTDPILANNPFVLTGEAWK 133
            ....|.|::.......::|..::..::.:.||..|.|.  ..||:.:.|| |..:.|.|.||.|:
  Fly    65 GQGPIAGMYMFFKRTALITDLDFIKQVMIKDFSYFQDR--GAFTNPRDDP-LTGHLFALEGEEWR 126

  Fly   134 ERRAEVTPGLSANRVKAAYPVSLRVCKKFVEYIRRQSLMAPAQ--GLNAKDLCLCYTTEVISDCV 196
            ..|.::||..::.::|....|.:.|..:..:.:.:....|..:  .:..||||..:||:||..|.
  Fly   127 AMRHKLTPVFTSGKIKQMSKVIVDVGLRLGDAMDKAVKEAKVEEGNVEIKDLCARFTTDVIGSCA 191

  Fly   197 LGISAQSFTDNPTPMVGMTKRVFE--------QSFGFIFYTVVANLWPPITKFYSVSLFAKDVAA 253
            .|:...|..|.........:.:|.        |||.|....:...|        .:.:...|:..
  Fly   192 FGLECNSLQDPSAEFRQKGREIFTRRRHSTLVQSFIFTNARLARKL--------RIKVLPDDLTQ 248

  Fly   254 FFYDLMQKCIQVRRESPAAQQRDDFLNYMLQL----QE--KK--------GLNAAELTSHTMTFL 304
            ||...::..:..|.::  ..:|:||:..|::|    ||  ||        ||...::.:....|.
  Fly   249 FFMSTVKNTVDYRLKN--GIKRNDFIEQMIELRAEDQEAAKKGQGIDLSHGLTLEQMAAQAFVFF 311

  Fly   305 TDGFETTAQVLTHTLLFLARNPKEQMKLREEIGT-------AELTFEQISELPFTEACIHETLRI 362
            ..||||::..::..|..||..|..|.:|||||.:       .||.::.::::.:.:..:.||||.
  Fly   312 VAGFETSSSTMSLCLYELALQPDIQQRLREEIESVLANVDGGELNYDVLAQMTYLDQVLSETLRK 376

  Fly   363 FSPVLAARKVVTEPCELTNKNGVSVKLRPGDVVIIPVNALHHDPQYYEEPQSFKPERFLNINGGA 427
            ...:....:..|:..::.|.:   :.|..|.:.:|||:.:||||:.|.||:.|.|.||   :...
  Fly   377 HPLLPHLIRETTKDYQIPNSD---IVLDKGILALIPVHNIHHDPEIYPEPEKFDPSRF---DPEE 435

  Fly   428 KKYRDQGLFFGFGDGPRICPGMRFSLTQIKAALVEIVRNFDIKVNPKTRKDNEIDDTYFMPALKG 492
            .|.|....:..||||||.|.|:||...|.|..||.::|.|...|:.:|..........|:.....
  Fly   436 VKNRHPMAYLPFGDGPRNCIGLRFGKIQAKIGLVSLLRRFKFSVSNRTDVPLIFSKKSFLLTTND 500

  Fly   493 GVWLDFVER 501
            |::|. |||
  Fly   501 GIYLK-VER 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28d1NP_608912.1 p450 35..477 CDD:278495 126/473 (27%)
Cyp6a14NP_001286199.1 p450 32..506 CDD:306555 129/495 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I2119
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1621
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
77.070

Return to query results.
Submit another query.