DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28d2 and ERG11

DIOPT Version :9

Sequence 1:NP_608911.1 Gene:Cyp28d2 / 33748 FlyBaseID:FBgn0031688 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_011871.1 Gene:ERG11 / 856398 SGDID:S000001049 Length:530 Species:Saccharomyces cerevisiae


Alignment Length:373 Identity:82/373 - (21%)
Similarity:139/373 - (37%) Gaps:67/373 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 ERRSEIMPALSPNRVKAVYPVSQSVCKKFVEYIRRQQQMATSEGLDAMDLSLCYTTEVVSDCGLG 198
            |::..:..||:....|:..|:   :.::..:|.|..:....:|          .||..:......
Yeast   149 EQKKFVKGALTKEAFKSYVPL---IAEEVYKYFRDSKNFRLNE----------RTTGTIDVMVTQ 200

  Fly   199 VSAQSFTDTPTPLLKMIKRVFNTSFEFIFYS----------VVTNLWQKVRKFYSVPFFNKETEV 253
            .....||.:.:.|.|.::...:|.|.:::..          |..||  .:..:.......|....
Yeast   201 PEMTIFTASRSLLGKEMRAKLDTDFAYLYSDLDKGFTPINFVFPNL--PLEHYRKRDHAQKAISG 263

  Fly   254 FFLDIIRRCITLRLEKPEQQRDDFLNYMLQLQEKKGLH-TDNILINTMTFIL-DGFETTALVLAH 316
            .::.:|:.   .|.....|.||...:.|.....|.|:. ||..:.|.:..:| .|..|:|...|.
Yeast   264 TYMSLIKE---RRKNNDIQDRDLIDSLMKNSTYKDGVKMTDQEIANLLIGVLMGGQHTSAATSAW 325

  Fly   317 IMLMLGRNPEEQDKVRKEI------GSADLTFDQMSELPHLDACIYETLRLFSPQVAARKLVTEP 375
            |:|.|...|:.|.::.:|.      |..:||:|.:.|:|.|:..|.||||:..|..:..:.|.:.
Yeast   326 ILLHLAERPDVQQELYEEQMRVLDGGKKELTYDLLQEMPLLNQTIKETLRMHHPLHSLFRKVMKD 390

  Fly   376 FEFANKN-----GRTVHLKPGDVVTIPVKALHHDPQYYEDPLTFKPERFLESNGGGMKSYR---- 431
            ....|.:     |..|.:.||        ..|...:|:.:...|...|:   |.....||.    
Yeast   391 MHVPNTSYVIPAGYHVLVSPG--------YTHLRDEYFPNAHQFNIHRW---NKDSASSYSVGEE 444

  Fly   432 --------DRGV---YLAFGDGPRHCPGMRFALTQLKAALVEILRNFE 468
                    .:||   ||.||.|...|.|..||..||...:...:|..:
Yeast   445 VDYGFGAISKGVSSPYLPFGGGRHRCIGEHFAYCQLGVLMSIFIRTLK 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28d2NP_608911.1 p450 38..475 CDD:299894 82/373 (22%)
ERG11NP_011871.1 CYP51-like 83..521 CDD:410668 82/373 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I1492
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1477
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.