DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28d2 and CYP709B3

DIOPT Version :9

Sequence 1:NP_608911.1 Gene:Cyp28d2 / 33748 FlyBaseID:FBgn0031688 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_194501.1 Gene:CYP709B3 / 828885 AraportID:AT4G27710 Length:518 Species:Arabidopsis thaliana


Alignment Length:526 Identity:110/526 - (20%)
Similarity:213/526 - (40%) Gaps:91/526 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VTTFLVLVLTLLVLVYVFLTWNFNY------------WRKRGIKTAPTWPFV-GSFPSIFTRKRN 55
            ::|..:|.:.||:.| |...|...:            ::|:|| :.|.:..: |:...|...|:.
plant     4 ISTINLLTIVLLLFV-VSKIWKACWILLLRPLMLSKRFKKQGI-SGPKYKILYGNLSEIKKMKKE 66

  Fly    56 IAYDIDD---------IYEKYKDTDNMVG----VFTTRVPQLLVMCPEYIHKIYATDFRSFHNNE 107
            ....:.|         ::.:|....:..|    .:|...|.:.:...|...::.::.|       
plant    67 ADLCVLDPNSNDIFPRVFPQYHQWMSQYGDTFLFWTGTKPTIYISNHELAKQVLSSKF------- 124

  Fly   108 WRNFV-----NKKTDMILGNNPFVLTGDEWKERRSEIMPALSPNRVKAV-YPVSQSVCKKFVEYI 166
              .|.     ..:..::.|.....:.||:|...|..:.||.|.:|:||: .|:.....:.|.|: 
plant   125 --GFTIIPVKRPEVFILFGKGLSFIQGDDWIRHRRILNPAFSMDRLKAMTQPMGDCTLRIFEEW- 186

  Fly   167 RRQQQMATSEGLDAMDLSLCY---TTEVVSDCGLGVS-------AQSFTDTPTPLLKMIKRVFNT 221
              ::|....|.|..:::|..:   |.::::....|.|       .:|.|:.....:..:..||..
plant   187 --RKQRRNGEVLIKIEISKEFHKLTADIIATTAFGSSYAEGIELCRSQTELEKYYISSLTNVFIP 249

  Fly   222 SFEFIFYSVVTNLWQKVRKFYSVPFFNKETEVFFLDIIRRCITLRLE---KPEQQRDDFLNYMLQ 283
            ..:::.......||:..:|              ..:.|:|.|..||:   |.....||.|..||.
plant   250 GTQYLPTPTNLKLWELHKK--------------VKNSIKRIIDSRLKSKCKTYGYGDDLLGVMLT 300

  Fly   284 L----QEKKGLHTDNILINTMTFILDGFETTALVLAHIMLMLGRNPEEQDKVRKEI----GSADL 340
            .    :.::.:..|.|:.....|...|..||:::|....::|..:...|:|:|:|:    |...:
plant   301 AAKSNEYERKMRMDEIIEECKNFYYAGQGTTSILLTWTTMLLSLHQGWQEKLREEVFNECGKDKI 365

  Fly   341 -TFDQMSELPHLDACIYETLRLFSPQVAARKLVTEPFEFANKNGRTVHLKPGDVVTIPVKALHHD 404
             ..|..|:|..::..:.|:|||:.|.:...:..|:..:..:     :.:..|..:.||:..:|.|
plant   366 PDTDTFSKLKLMNMVLMESLRLYGPVIKISREATQDMKVGH-----LEIPKGTSIIIPLLKMHRD 425

  Fly   405 PQYY-EDPLTFKPERFLESNGGGMKSYRDRGVYLAFGDGPRHCPGMRFALTQLKAALVEILRNFE 468
            ...: ||...|.|.||  .||....:.....: |.|..|||.|....||:.:.|..|..||:.|:
plant   426 KAIWGEDAEQFNPLRF--ENGISQATIHPNAL-LPFSIGPRACIAKNFAMVEAKTVLTMILQQFQ 487

  Fly   469 IKVNPK 474
            :.::|:
plant   488 LSLSPE 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28d2NP_608911.1 p450 38..475 CDD:299894 100/480 (21%)
CYP709B3NP_194501.1 p450 9..517 CDD:299894 109/521 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.