DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28d2 and sad

DIOPT Version :9

Sequence 1:NP_608911.1 Gene:Cyp28d2 / 33748 FlyBaseID:FBgn0031688 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster


Alignment Length:376 Identity:80/376 - (21%)
Similarity:148/376 - (39%) Gaps:73/376 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 DEWKERRSEIMPALSPNRVKAVYPVSQSVCKKFVEYIRRQQQMATSEGLDAMDLSLC--YTTEVV 192
            |:||.|.:|          .|..|:::|...:..|....:||:...    ::::..|  :.|.|:
  Fly   189 DQWKRRTAE----------AAAIPLAESGEIRSYELPLLEQQLYRW----SIEVLCCIMFGTSVL 239

  Fly   193 SDCGLGVSAQSFTDTPTPLLKMIKRVFNTSFEFIFYSVVTNLWQKVRKFYSVPFFNKETEVFFLD 257
            :...:..|...||       :::.:||..|...:.:.      .::.:...:|.: ::.|....:
  Fly   240 TCPKIQSSLDYFT-------QIVHKVFEHSSRLMTFP------PRLAQILRLPIW-RDFEANVDE 290

  Fly   258 IIR-------RCITLRLEKPEQQRDDFLNYMLQLQEKKGLHTDNILINTMTFILDGFETTALVLA 315
            ::|       .||.:: |...:..|:.|.:.||..:..|.....|.::   .::...:|||....
  Fly   291 VLREGAAIIDHCIRVQ-EDQRRPHDEALYHRLQAADVPGDMIKRIFVD---LVIAAGDTTAFSSQ 351

  Fly   316 HIMLMLGRNPEEQDKVRKEIGSADLTFDQMSELPHLDACIYETLRLFSPQVAARKLVTEPF---- 376
            ..:..|.:.|..|.::.||..:.|      |.|.|  ..|.|:|||:.         ..||    
  Fly   352 WALFALSKEPRLQQRLAKERATND------SRLMH--GLIKESLRLYP---------VAPFIGRY 399

  Fly   377 --EFANKNGRTVHLKPGDVVTIPVKALHHDPQYYEDPLTFKPERFLESNGGGMKSYRDRGVYLAF 439
              :.|...|.  .::...:|.:.:.....||.::|.|....|||:  ..|...:.::..| .|.|
  Fly   400 LPQDAQLGGH--FIEKDTMVLLSLYTAGRDPSHFEQPERVLPERW--CIGETEQVHKSHG-SLPF 459

  Fly   440 GDGPRHCPGMRFALTQLKAALVEILRNFEIKVNPKTRSDNQIDDTFFMATL 490
            ..|.|.|.|.|.||.||.:.|......||:    ...::..:|....|.|:
  Fly   460 AIGQRSCIGRRVALKQLHSLLGRCAAQFEM----SCLNEMPVDSVLRMVTV 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28d2NP_608911.1 p450 38..475 CDD:299894 77/359 (21%)
sadNP_650123.1 p450 63..497 CDD:299894 77/365 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.