DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28d2 and Cyp12a4

DIOPT Version :9

Sequence 1:NP_608911.1 Gene:Cyp28d2 / 33748 FlyBaseID:FBgn0031688 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_650783.2 Gene:Cyp12a4 / 42294 FlyBaseID:FBgn0038681 Length:536 Species:Drosophila melanogaster


Alignment Length:418 Identity:108/418 - (25%)
Similarity:176/418 - (42%) Gaps:77/418 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 FHNNEWRNFVNKKTDMILGNNPFVLT-GDEWKERRSEIMPAL-SPNRVKAVYPVSQSVCKKFVEY 165
            :|..|:|.      |...|....:.| |..|.:.|:.:.|.| .|..|:..|.....|.::||:.
  Fly   130 YHREEYRK------DFYQGVMGVIPTQGKPWGDFRTVVNPVLMQPKNVRLYYKKMSQVNQEFVQR 188

  Fly   166 IRRQQQMATSEGL-DAMDLSLCYTTEVVS----DCGLGVSAQSFTDTPTPLLKMIKRVFNTSFEF 225
            |...:...|.|.. |.:|....:|.|.||    |..||:...|  :..:..||:    |:...||
  Fly   189 ILELRDPDTLEAPDDFIDTINRWTLESVSVVALDKQLGLLKNS--NKESEALKL----FHYLDEF 247

  Fly   226 IFYSVVTNLWQKVRKFYSVPFFNKETEVFFLDIIRRCITL--------RLEK--------PEQQR 274
            ...|:...:.....::...|...:....  ||.|:. :||        ||:|        ||.::
  Fly   248 FIVSIDLEMKPSPWRYIKTPKLKRLMRA--LDGIQE-VTLAYVDEAIERLDKEAKEGVVRPENEQ 309

  Fly   275 DDFLNYMLQLQEKKGLHTDNILINTMTFILDGFETTALVLAHIMLMLGRNPEEQDKVRKEI---- 335
             ..|..:|::..|..      .:..|..::.|.:||:.....::|.|.:|||:|.::|:|:    
  Fly   310 -SVLEKLLKVDRKVA------TVMAMDMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKVL 367

  Fly   336 --GSADLTFDQMSELPHLDACIYETLRLF-----SPQVAARKLVTEPFEFANKNGRTVHLKPGDV 393
              .:::.|...|..:|:|.|||.|:.||.     :.:|.||..|...:          .:..|..
  Fly   368 PNKNSEFTEASMKNVPYLRACIKESQRLHPLIVGNARVLARDAVLSGY----------RVPAGTY 422

  Fly   394 VTI-PVKALHHDPQYYEDPLTFKPERFLES--------NGGGMKSYRDRGVYLAFGDGPRHCPGM 449
            |.| |:.||..| :|:.....|.|||:|.|        ....:|| .:..|:|.||.|||.|.|.
  Fly   423 VNIVPLNALTRD-EYFPQASEFLPERWLRSPKDSESKCPANELKS-TNPFVFLPFGFGPRMCVGK 485

  Fly   450 RFALTQLKAALVEILRNFEIKVNPKTRS 477
            |....:|:.....::|||.::.|..|.:
  Fly   486 RIVEMELELGTARLIRNFNVEFNYPTEN 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28d2NP_608911.1 p450 38..475 CDD:299894 107/414 (26%)
Cyp12a4NP_650783.2 p450 72..531 CDD:299894 108/418 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.