DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28d2 and Cyp12e1

DIOPT Version :9

Sequence 1:NP_608911.1 Gene:Cyp28d2 / 33748 FlyBaseID:FBgn0031688 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_650003.4 Gene:Cyp12e1 / 41272 FlyBaseID:FBgn0037817 Length:522 Species:Drosophila melanogaster


Alignment Length:484 Identity:112/484 - (23%)
Similarity:190/484 - (39%) Gaps:107/484 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 IYEKYKDTDNMVG-VFTTRVPQ------LLVMCPEYIHKIYATD-----FRSFHNNEWRNFVNKK 115
            ::|.:.|.:...| :|  |:|.      :|.|.|:....|:..:     .|||...::...|:::
  Fly    64 VHEMFLDMNRQYGSIF--RMPSVAGTDLVLTMNPQDYEVIFRNEGQYPYRRSFEVMDYFKRVHRR 126

  Fly   116 ------TDMILGNNPFVLTGDEWKERRSEIMP-ALSPNRVKAVYPVSQSVCKKFVEYIRRQQQMA 173
                  ..:..||.|      .|.:.|:.:.| .|.|...|........|..:|:|.||..:...
  Fly   127 EVFDGYDGLTSGNGP------AWGKMRTAVNPILLQPRNAKLYMTNLVQVSDEFLERIRIIRDPV 185

  Fly   174 TSEGLD--AMDL------SLCYTTEVVSDCGLGVSAQSFTDTP-TPLLKMIKRVFNTSFEFIFYS 229
            |.|..|  |:|:      |:|   .|..:..||:..:...:.. ..|:..::.|....|:.   .
  Fly   186 TQEMPDDFAVDIRHLVIESIC---SVALNTHLGLLGEQRNNKDIQKLVLALQDVVELGFQL---D 244

  Fly   230 VVTNLWQKVRKFYSVPFFNKETEVFFLDIIRRCITLRLEKPEQQRDDFL-----NYMLQLQE--- 286
            ::...|    |:..:|.|.|        ::|...|:         .||.     |.:.:::|   
  Fly   245 IMPAFW----KYLPMPNFKK--------LMRSLDTI---------TDFCYFHIGNALKRIEEDAK 288

  Fly   287 -----KKGLHT-----------DNILINTMTFILDGFETTALVLAHIMLMLGRNPEEQDKVRKEI 335
                 :.||.|           ...:|..|..:..|.:.|.:.|..|:..|.::|::|.::.:||
  Fly   289 AGTLNEIGLETSLLEKLARFDRQTAVIIAMDLLFAGADPTLVTLGGILFSLSKSPDKQARLLEEI 353

  Fly   336 ------GSADLTFDQMSELPHLDACIYETLRLFSPQVAARKLVTEPFEFANKNGRTVHLKPGDVV 394
                  ..:.||.:.|..||:|.|||.|.:|::  .:....|...|.:......|.|   .|..|
  Fly   354 RGILPNKDSSLTIENMRNLPYLRACIKEGIRMY--PIGPGTLRRMPHDVVLSGYRVV---AGTDV 413

  Fly   395 TIPVK-ALHHDPQYYEDPLTFKPERFL--ESNGGGMKSYRDRGVYLAFGDGPRHCPGMRFALTQL 456
            .|... .:.:..|:......|.|||:|  |||...:.......:||.||.|||.|.|.|.....|
  Fly   414 GIAANYQMANMEQFVPKVREFIPERWLRDESNSHLVGETATPFMYLPFGFGPRSCAGKRIVDMML 478

  Fly   457 KAALVEILRNFEIKVNPKTRSDNQIDDTF 485
            :.|:..::|||:|..      |..|::.|
  Fly   479 EIAISRLVRNFKIGF------DYPIENAF 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28d2NP_608911.1 p450 38..475 CDD:299894 109/472 (23%)
Cyp12e1NP_650003.4 p450 63..517 CDD:299894 112/484 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.