DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28d2 and Cyp12c1

DIOPT Version :9

Sequence 1:NP_608911.1 Gene:Cyp28d2 / 33748 FlyBaseID:FBgn0031688 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001287109.1 Gene:Cyp12c1 / 40037 FlyBaseID:FBgn0036806 Length:524 Species:Drosophila melanogaster


Alignment Length:479 Identity:115/479 - (24%)
Similarity:193/479 - (40%) Gaps:109/479 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 IDDIYEKYKD-------TDNMVG----VFTTRVPQLLVMCPEYIHKIYATDFRSFHNNEWR---- 109
            :||:...||.       ...:.|    |||..|        |...|:|.|:      .:|.    
  Fly    67 MDDVMRLYKKQFGDICLIPGLFGMPSTVFTFNV--------ETFEKVYRTE------GQWPVRGG 117

  Fly   110 -----NFVNKKTDM-------ILGNNPFVLTGDEWKERRSEIMPALSPNRVKAVY--PVSQSVCK 160
                 ::.||:.|.       :.||      |.||.:.||.:.|.|..:|..|:|  |: |.|.:
  Fly   118 AEPVIHYRNKRKDEFFKNCMGLFGN------GAEWGKNRSAVNPVLMQHRNVAIYLKPM-QRVNR 175

  Fly   161 KFVEYIR----RQQQMATSEGLDAMD-LSLCYTTEVVSDCGLGVSAQSFTDTPTPLLKMIKRVFN 220
            :||..||    ::.|....:.::.:: |:......|..|..||:..::  :.|....|:.|.:..
  Fly   176 QFVNRIREIRDKESQEVPGDFMNTINHLTFESVATVALDRELGLLREA--NPPPEASKLFKNIEV 238

  Fly   221 TSFEFIFYSVVTNLWQKVRKFYSVPFFNKETEVFFLDIIRRCITL------RLEKPEQQRD---- 275
            ....|....|..:|:    ::...|.:.|.:.... :|...|...      |:::...|.|    
  Fly   239 LMDSFFDLGVRPSLY----RYIPTPTYKKFSRAMD-EIFDTCSMYVNQAIERIDRKSSQGDSNDH 298

  Fly   276 -DFLNYMLQLQEKKGLHTDNILINTMTFILDGFETTALVLAHIMLMLGRNPEEQDKVRKEIGS-- 337
             ..|..:||:..|..      ::..|..::.|.:||:..::.|:|.|.:|||:|.::|:|:.|  
  Fly   299 KSVLEQLLQIDRKLA------VVMAMDMLMGGVDTTSTAISGILLNLAKNPEKQQRLREEVLSKL 357

  Fly   338 ----ADLTFDQMSELPHLDACIYETLRLFSPQVAARKLVTEPFEFANKN--GRTV-----HLKPG 391
                ::.|.:.|..||:|.|.|.|:|||:            |..|.|..  |..|     .:..|
  Fly   358 TSLHSEFTVEDMKSLPYLRAVIKESLRLY------------PVTFGNARSAGADVVLDGYRIPKG 410

  Fly   392 DVVTIPVKALHHDPQYYEDPLTFKPERFLESNGGG-----MKSYRDRGVYLAFGDGPRHCPGMRF 451
            ..:.:....|..|.:.|.....|.|||:|......     |....:..:||.||.|||.|.|.|.
  Fly   411 TKLLMTNSFLLKDDRLYPRAKEFIPERWLRRKDDDKSDVLMNKDLNAFIYLPFGFGPRMCVGKRI 475

  Fly   452 ALTQLKAALVEILRNFEIKVNPKT 475
            ...:::..:..::|||.|:.|..|
  Fly   476 VDLEMELTVANLVRNFHIEYNYST 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28d2NP_608911.1 p450 38..475 CDD:299894 114/477 (24%)
Cyp12c1NP_001287109.1 p450 45..502 CDD:278495 115/479 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.