DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28d2 and Cyp12b2

DIOPT Version :9

Sequence 1:NP_608911.1 Gene:Cyp28d2 / 33748 FlyBaseID:FBgn0031688 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_611370.2 Gene:Cyp12b2 / 37163 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster


Alignment Length:460 Identity:116/460 - (25%)
Similarity:191/460 - (41%) Gaps:78/460 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VGSFPSIFTRKRNIAYDIDDIYEKYKDTDNMVGVFTTRVPQLLVMCPEYIHKIYATDFRSFHNNE 107
            :|...::||      |:.||....|::.    ||:..|:.   :....|..||:..|        
  Fly   100 MGKPNAVFT------YNPDDFEMTYRNE----GVWPIRIG---LESLNYYRKIHRPD-------- 143

  Fly   108 WRNFVNKKTDMILGNNPFVLTGDEWKERRSEIMPAL-SPNRVKAVYPVSQSVCKKFVEYIRRQQQ 171
                |.|....:..:.     |.||.:.|:::.|.| ....|:...|....:.|:|::.:..|:.
  Fly   144 ----VFKGVGGLASDQ-----GQEWADIRNKVNPVLMKVQNVRQNLPQLDQISKEFIDKLETQRN 199

  Fly   172 MAT-SEGLDAMDLSLCYTTEVVSDCGLGVSAQSFTDTPTP----LLKMIKRVFNTSFEFIFYSVV 231
            ..| :...|..:....:..|.:|...|.......:|.|.|    |.|.::..||.||:|   .|.
  Fly   200 PETHTLTTDFHNQLKMWAFESISFVALNTRMGLLSDNPDPNADRLAKHMRDFFNYSFQF---DVQ 261

  Fly   232 TNLWQKVRKFYSVPFFNKETEVF--FLDIIRRCITLRLEKPEQQRDDFLNYML-QLQEKKGLHTD 293
            .::|    .||....|.|..:.:  ..||....|...:....:..|.....:| ||.|    |..
  Fly   262 PSIW----TFYKTAGFKKFLKTYDNITDITSNYIETAMRGFGKNDDGKTKCVLEQLLE----HNK 318

  Fly   294 NILIN-TMTFILDGFETTALVLAHIMLMLGRNPEEQDKVRKEI------GSADLTFDQMSELPHL 351
            .:.:. .|..::.|.:||:.....|:..|.|||.:|:|:|:|:      ....||......:|:|
  Fly   319 KVAVTMVMDMLMAGIDTTSSACLTILYHLARNPSKQEKLRRELLRILPTTKDSLTDQNTKNMPYL 383

  Fly   352 DACIYETLRLFS--P---QVAARKLVTEPFEFANKNGRTVHLKPGDVVTIPVKALHHDPQYYEDP 411
            .|||.|.||:.|  |   ::..:.||...::.....|          |.:.|..|.:|.:|:...
  Fly   384 RACIKEGLRITSITPGNFRITPKDLVLSGYQVPRGTG----------VLMGVLELSNDDKYFAQS 438

  Fly   412 LTFKPERFLESNGG----GMKSYRDRG--VYLAFGDGPRHCPGMRFALTQLKAALVEILRNFEIK 470
            ..|.|||:|:|:..    ...:.|.|.  |||.||.|||.|.|.|.|..:::..||.:||::::.
  Fly   439 SEFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVS 503

  Fly   471 VNPKT 475
            ..|:|
  Fly   504 WLPET 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28d2NP_608911.1 p450 38..475 CDD:299894 115/458 (25%)
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 116/460 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.