DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-13A and AT3G03070

DIOPT Version :9

Sequence 1:NP_001285613.1 Gene:ND-13A / 33744 FlyBaseID:FBgn0031684 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_566191.1 Gene:AT3G03070 / 821133 AraportID:AT3G03070 Length:110 Species:Arabidopsis thaliana


Alignment Length:59 Identity:30/59 - (50%)
Similarity:38/59 - (64%) Gaps:3/59 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IKLIEEVPPKECTERVVFCDGGDGP-LGHPKVYINLDKPGNHICGYCGLRFVKKDDHHH 126
            ::||.||||.:...|:|.|:|...| ||||..:|.||.....||.|||||:|:  ||||
plant    54 MELISEVPPIKVDGRIVACEGDTNPALGHPIEFICLDLNEPAICKYCGLRYVQ--DHHH 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-13ANP_001285613.1 zf-CHCC 83..118 CDD:287277 18/35 (51%)
AT3G03070NP_566191.1 zf-CHCC 67..104 CDD:402066 18/36 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641902at2759
OrthoFinder 1 1.000 - - FOG0005607
OrthoInspector 1 1.000 - - oto3544
orthoMCL 1 0.900 - - OOG6_103470
Panther 1 1.100 - - LDO PTHR13156
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4016
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.