DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-13A and Ndufs6

DIOPT Version :10

Sequence 1:NP_608909.1 Gene:ND-13A / 33744 FlyBaseID:FBgn0031684 Length:126 Species:Drosophila melanogaster
Sequence 2:XP_063129356.1 Gene:Ndufs6 / 679739 RGDID:1584802 Length:122 Species:Rattus norvegicus


Alignment Length:67 Identity:40/67 - (59%)
Similarity:51/67 - (76%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EKVTHTGQVFDKEDYRNARFVNAKRYVNENWGIKLIEEVPPKECTERVVFCDGGDGPLGHPKVYI 101
            ||:||||||:|::|||..|||:.::.||||:.|.||.:.|..|...|::.||||.|.||||||||
  Rat    29 EKITHTGQVYDEKDYRRIRFVDRQKEVNENFAIDLIAQQPVNEVDHRIIACDGGGGALGHPKVYI 93

  Fly   102 NL 103
            ||
  Rat    94 NL 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-13ANP_608909.1 zf-CHCC 83..118 CDD:463041 16/21 (76%)
Ndufs6XP_063129356.1 None

Return to query results.
Submit another query.