DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-13A and NDUFS6

DIOPT Version :9

Sequence 1:NP_001285613.1 Gene:ND-13A / 33744 FlyBaseID:FBgn0031684 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_004544.1 Gene:NDUFS6 / 4726 HGNCID:7713 Length:124 Species:Homo sapiens


Alignment Length:91 Identity:55/91 - (60%)
Similarity:62/91 - (68%) Gaps:4/91 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EKVTHTGQVFDKEDYRNARFVNAKRYVNENWGIKLIEEVPPKECTERVVFCDGGDGPLGHPKVYI 101
            |||||||||:|.:|||..|||..::.||||:.|.||.|.|..|...||:.||||.|.||||||||
Human    37 EKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYI 101

  Fly   102 NLDK-PGNHICGYCGLRFVKKDDHHH 126
            |||| .....||||||:|   ..|||
Human   102 NLDKETKTGTCGYCGLQF---RQHHH 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-13ANP_001285613.1 zf-CHCC 83..118 CDD:287277 25/35 (71%)
NDUFS6NP_004544.1 zf-CHCC 82..119 CDD:370944 25/36 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148750
Domainoid 1 1.000 57 1.000 Domainoid score I10954
eggNOG 1 0.900 - - E1_KOG3456
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37935
Inparanoid 1 1.050 111 1.000 Inparanoid score I4884
Isobase 1 0.950 - 0 Normalized mean entropy S3747
OMA 1 1.010 - - QHG49538
OrthoDB 1 1.010 - - D1641902at2759
OrthoFinder 1 1.000 - - FOG0005607
OrthoInspector 1 1.000 - - oto91547
orthoMCL 1 0.900 - - OOG6_103470
Panther 1 1.100 - - LDO PTHR13156
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2668
SonicParanoid 1 1.000 - - X4016
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.