DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-13A and NDUFS6

DIOPT Version :10

Sequence 1:NP_608909.1 Gene:ND-13A / 33744 FlyBaseID:FBgn0031684 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_004544.1 Gene:NDUFS6 / 4726 HGNCID:7713 Length:124 Species:Homo sapiens


Alignment Length:91 Identity:55/91 - (60%)
Similarity:62/91 - (68%) Gaps:4/91 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EKVTHTGQVFDKEDYRNARFVNAKRYVNENWGIKLIEEVPPKECTERVVFCDGGDGPLGHPKVYI 101
            |||||||||:|.:|||..|||..::.||||:.|.||.|.|..|...||:.||||.|.||||||||
Human    37 EKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYI 101

  Fly   102 NLDK-PGNHICGYCGLRFVKKDDHHH 126
            |||| .....||||||:|   ..|||
Human   102 NLDKETKTGTCGYCGLQF---RQHHH 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-13ANP_608909.1 zf-CHCC 83..118 CDD:463041 25/35 (71%)
NDUFS6NP_004544.1 zf-CHCC 82..119 CDD:463041 25/36 (69%)

Return to query results.
Submit another query.