DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-13A and Ndufs6

DIOPT Version :9

Sequence 1:NP_001285613.1 Gene:ND-13A / 33744 FlyBaseID:FBgn0031684 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_035018.1 Gene:Ndufs6 / 407785 MGIID:107932 Length:116 Species:Mus musculus


Alignment Length:91 Identity:52/91 - (57%)
Similarity:64/91 - (70%) Gaps:4/91 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EKVTHTGQVFDKEDYRNARFVNAKRYVNENWGIKLIEEVPPKECTERVVFCDGGDGPLGHPKVYI 101
            ||:||||||:|::|||..|||:.::.||||:.|.||.:.|..|...|::.||||.|.||||||||
Mouse    29 EKITHTGQVYDEKDYRRVRFVDRQKEVNENFAIDLIAQQPVNEVEHRIIACDGGGGALGHPKVYI 93

  Fly   102 NLDK-PGNHICGYCGLRFVKKDDHHH 126
            |||| .....||||||:|   ..|||
Mouse    94 NLDKETKTGTCGYCGLQF---KQHHH 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-13ANP_001285613.1 zf-CHCC 83..118 CDD:287277 24/35 (69%)
Ndufs6NP_035018.1 zf-CHCC 75..111 CDD:402066 24/35 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838836
Domainoid 1 1.000 57 1.000 Domainoid score I10888
eggNOG 1 0.900 - - E1_KOG3456
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37935
Inparanoid 1 1.050 111 1.000 Inparanoid score I4864
Isobase 1 0.950 - 0 Normalized mean entropy S3747
OMA 1 1.010 - - QHG49538
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005607
OrthoInspector 1 1.000 - - oto95129
orthoMCL 1 0.900 - - OOG6_103470
Panther 1 1.100 - - LDO PTHR13156
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2668
SonicParanoid 1 1.000 - - X4016
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.