DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-13A and ndufs6

DIOPT Version :9

Sequence 1:NP_001285613.1 Gene:ND-13A / 33744 FlyBaseID:FBgn0031684 Length:126 Species:Drosophila melanogaster
Sequence 2:XP_002941817.3 Gene:ndufs6 / 100127764 XenbaseID:XB-GENE-1009702 Length:165 Species:Xenopus tropicalis


Alignment Length:127 Identity:62/127 - (48%)
Similarity:75/127 - (59%) Gaps:12/127 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KQLVNNLSKLGLPRQN-WMSPLASVRHSSCRGDI--EKVTHTGQVFDKEDYRNARFVNAKRYVNE 65
            |...||.:.:|....| |.      |:.:.:..:  ||:||||||||:.|||..|||..::.|||
 Frog    47 KGATNNNTAIGYLGSNCWR------RNYTAKVSVTGEKITHTGQVFDEYDYRKVRFVGRQKEVNE 105

  Fly    66 NWGIKLIEEVPPKECTERVVFCDGGDGPLGHPKVYINLDK-PGNHICGYCGLRFVKKDDHHH 126
            .:.|.||.|.|..|...|:|.||||.|.|||||||||||| .....||||||:|  |..|||
 Frog   106 QFAINLIAEQPANESDSRIVSCDGGGGALGHPKVYINLDKETKTGTCGYCGLQF--KQKHHH 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-13ANP_001285613.1 zf-CHCC 83..118 CDD:287277 25/35 (71%)
ndufs6XP_002941817.3 zf-CHCC 122..159 CDD:402066 25/36 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10763
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37935
Inparanoid 1 1.050 113 1.000 Inparanoid score I4716
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641902at2759
OrthoFinder 1 1.000 - - FOG0005607
OrthoInspector 1 1.000 - - oto105313
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2668
SonicParanoid 1 1.000 - - X4016
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.