DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4230 and hax1

DIOPT Version :9

Sequence 1:NP_001260087.1 Gene:CG4230 / 33743 FlyBaseID:FBgn0031683 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001002337.1 Gene:hax1 / 436609 ZFINID:ZDB-GENE-040718-26 Length:286 Species:Danio rerio


Alignment Length:336 Identity:62/336 - (18%)
Similarity:106/336 - (31%) Gaps:131/336 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FKSEAAKEP--DSSVSASNKDE----FRKPQWFEEAETDDELFDDDRKFAFQV------FTSPLE 60
            ::.:..::|  |..:...:.||    |.:|.        .:.|||..:|.|..      |..|..
Zfish    18 YREDGRRDPFFDGMIHEDDDDEDEDDFNRPH--------RDPFDDAFRFGFSFGPGGARFEEPQM 74

  Fly    61 MQKHFESQLQRLLESLNDKDDGFERDLKEDFLKPGFESKILKKFEQQKDFSLDTDLDGEIYADQL 125
            ..:.|                   ||::|.|...|       :|:::..|           ..:.
Zfish    75 FGQIF-------------------RDMEEMFAGLG-------RFDERHGF-----------GPRG 102

  Fly   126 HSLIQRLNPGENVESGDQVIGNILPSN----------------------QHGYRK---------- 158
            ...|:...|.|.||.|....|:..|..                      .|.:|:          
Zfish   103 FPSIEAPPPQEGVEKGRSGTGSGNPIRDFMLKSPDRSPKDPEHREDSPPNHPHRRPFSKFNDIWK 167

  Fly   159 -GVQRAKLTD--EEIIMGRIHGTISADGESQSYARPPRPPRNNKPDIMTPMTPMLPRSGMSPFGG 220
             |:.:.|..|  |:   |.:...:|:.|..|               |:....|..|::       
Zfish   168 DGLLKPKGEDKRED---GDLDSQVSSGGLDQ---------------ILKDPAPSQPKT------- 207

  Fly   221 VFDGNYQGPKLFSQSVMTKTVRKPDGSYETTKVTQDSSGHKTTTVT--RMKDGRKETIVTHDDGA 283
                     :.|.:||....|.:|||:.|..:..:|..|::.||||  ....|:...::  |...
Zfish   208 ---------RSFFKSVSVTKVVRPDGTVEERRTVRDGEGNEETTVTISERPGGQDRPVL--DQSG 261

  Fly   284 PTVGMGGKQLQ 294
            |.: .||..:|
Zfish   262 PLM-PGGSDMQ 271



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582128
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1567048at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14938
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.