DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4230 and HAX1

DIOPT Version :10

Sequence 1:NP_001260087.1 Gene:CG4230 / 33743 FlyBaseID:FBgn0031683 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_006109.2 Gene:HAX1 / 10456 HGNCID:16915 Length:279 Species:Homo sapiens


Alignment Length:154 Identity:39/154 - (25%)
Similarity:59/154 - (38%) Gaps:46/154 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 PGENVESGDQVIGNILP-SNQHGYRKGVQRAKLTDEEIIMGRIHGTISADGESQSYARPPRPP-- 195
            |||.:..|..:..::|. .:.|..|             |.|   |.:.:|..|:|    |:|.  
Human   115 PGERLREGQTLRDSMLKYPDSHQPR-------------IFG---GVLESDARSES----PQPAPD 159

  Fly   196 -RNNKP----DIMTPMTP------------MLPRSGMSPFGGVFDGNYQGPKLFSQSVMTKTVRK 243
             .:.:|    |.:.||.|            .:.:.|:.|   |....   ||.:.:|:....:.|
Human   160 WGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGLGP---VLQPQ---PKSYFKSISVTKITK 218

  Fly   244 PDGSYETTKVTQDSSGHKTTTVTR 267
            |||..|..:...||.|...|||||
Human   219 PDGIVEERRTVVDSEGRTETTVTR 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4230NP_001260087.1 None
HAX1NP_006109.2 Required for localization in mitochondria. /evidence=ECO:0000250 2..41
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..65
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 99..262 39/154 (25%)
Involved in HCLS1 binding 114..279 39/154 (25%)
Involved in CASP9 binding 175..206 6/36 (17%)
Involved in GNA13 binding 176..247 20/73 (27%)
Required for localization in sarcoplasmic reticulum. /evidence=ECO:0000250 183..279 19/66 (29%)
Involved in PKD2 binding 184..279 19/65 (29%)
Involved in ATP2A2 binding 203..245 16/43 (37%)
Involved in PLN binding 203..225 7/24 (29%)
Mediates interaction with UCP3. /evidence=ECO:0000250|UniProtKB:O35387 210..279 14/33 (42%)
Required for ITGB6 binding 270..279
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.