DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5828 and PANK3

DIOPT Version :9

Sequence 1:NP_001260085.1 Gene:CG5828 / 33742 FlyBaseID:FBgn0031682 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_078870.1 Gene:PANK3 / 79646 HGNCID:19365 Length:370 Species:Homo sapiens


Alignment Length:155 Identity:39/155 - (25%)
Similarity:54/155 - (34%) Gaps:56/155 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 RLQELDALADEDTRWTELVRGVLAGNMFDWGAQAISNILEQDSNFGLHSALDRIEKRPWLLDNLD 190
            :|.|||.          ||:|:|..:...:..||      :...|...|..:|.:|.|:.||   
Human   135 KLDELDC----------LVKGLLYIDSVSFNGQA------ECYYFANASEPERCQKMPFNLD--- 180

  Fly   191 SWLNRLKGEPHKCAVVFVDNSGVDVVLGVLPFVRGLLKRGTKVLLCANSEPALNDVTSEELK--- 252
                    :|:...||.: .|||.:                   |..:|:.....||...|.   
Human   181 --------DPYPLLVVNI-GSGVSI-------------------LAVHSKDNYKRVTGTSLGGGT 217

  Fly   253 -----SLLDDCSRECEVLEQAWSKG 272
                 |||..|....|.||.| |||
Human   218 FLGLCSLLTGCESFEEALEMA-SKG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5828NP_001260085.1 DUF89 54..347 CDD:280170 39/155 (25%)
PANK3NP_078870.1 Fumble 14..362 CDD:397611 39/155 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5146
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D865329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100565
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R888
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.