DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5828 and Pank1

DIOPT Version :9

Sequence 1:NP_001260085.1 Gene:CG5828 / 33742 FlyBaseID:FBgn0031682 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001107811.1 Gene:Pank1 / 75735 MGIID:1922985 Length:548 Species:Mus musculus


Alignment Length:148 Identity:34/148 - (22%)
Similarity:52/148 - (35%) Gaps:35/148 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 QELDALADED-TRWTELVRGVLAGNMFDWGAQAISNILEQDSNFGLHSALDRIEKRPWLLDNLDS 191
            :.||..|..| |...:||:.:..|:...:|.|. |.:.....|.......:.|.|.......|.:
Mouse   408 EALDMAAKGDSTNVDKLVKDIYGGDYERFGLQG-SAVASSFGNMMSKEKRESISKEDLARATLVT 471

  Fly   192 WLNRLKGEPHKCAVVFVDNSGVDVVLGVLPFVRGLLKRGTKVLLCANSEPALNDVTSEELKSLLD 256
            ..|.:......||:    |..:|.|:.|..|:|                  :|.|:.:.|...:|
Mouse   472 ITNNIGSIARMCAL----NENIDRVVFVGNFLR------------------INMVSMKLLAYAMD 514

  Fly   257 DCSRECEVLEQAWSKGQL 274
                       .||||||
Mouse   515 -----------FWSKGQL 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5828NP_001260085.1 DUF89 54..347 CDD:280170 34/148 (23%)
Pank1NP_001107811.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..120
Nucleolar localization signal. /evidence=ECO:0000269|PubMed:23152917 1..8
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..167
Nucleolar localization signal. /evidence=ECO:0000269|PubMed:23152917 168..185
Fumble 189..537 CDD:281610 34/148 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5146
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D865329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100565
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R888
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.