DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5828 and pank1b

DIOPT Version :9

Sequence 1:NP_001260085.1 Gene:CG5828 / 33742 FlyBaseID:FBgn0031682 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001077310.1 Gene:pank1b / 565059 ZFINID:ZDB-GENE-070209-259 Length:451 Species:Danio rerio


Alignment Length:143 Identity:30/143 - (20%)
Similarity:49/143 - (34%) Gaps:34/143 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 ALADEDTRWTELVRGVLAGNMFDWGAQAISNILEQDSNFGLHSALDRIEKRPWLLDNLDSWLNRL 196
            |...:.|...:||:.:..|:...:|.|. |.:.....:.......|.|.|.......|.:..|.:
Zfish   316 AAKGDSTNVDKLVKDIYGGDYERFGLQG-SAVASSFCHMMSKEKRDSISKEDLARATLVTITNNI 379

  Fly   197 KGEPHKCAVVFVDNSGVDVVLGVLPFVRGLLKRGTKVLLCANSEPALNDVTSEELKSLLDDCSRE 261
            ......|||    |..:|.|:.|..|:|                  :|.::::.|...:|     
Zfish   380 GSIARMCAV----NENIDKVVFVGNFLR------------------INTISTKLLAYAMD----- 417

  Fly   262 CEVLEQAWSKGQL 274
                  .||.|||
Zfish   418 ------FWSDGQL 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5828NP_001260085.1 DUF89 54..347 CDD:280170 30/143 (21%)
pank1bNP_001077310.1 Fumble 92..440 CDD:281610 30/143 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5146
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D865329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100565
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.