DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5828 and pank1a

DIOPT Version :9

Sequence 1:NP_001260085.1 Gene:CG5828 / 33742 FlyBaseID:FBgn0031682 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_005158562.1 Gene:pank1a / 406789 ZFINID:ZDB-GENE-040426-2846 Length:439 Species:Danio rerio


Alignment Length:199 Identity:45/199 - (22%)
Similarity:67/199 - (33%) Gaps:73/199 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 GKVILGTSELLKLNETLLRRYGFTDPWLRQKRLENASAVARLKQRLQELDALADEDTRWTELVRG 146
            |...||...||...||.            ::.||.||               ..:.|...:||:.
Zfish   281 GGTFLGLCCLLTGCETF------------EEALEMAS---------------KGDSTNVDKLVKD 318

  Fly   147 VLAGNMFDWGAQ--AISNILEQDSNFGLH----SALDRIEKRPWLLDNLDSWLNRLKGEPHKCAV 205
            :..|:...:|.|  |::      |:|| |    ...|.|.|.......|.:..|.:......|||
Zfish   319 IYGGDYQRFGLQGSAVA------SSFG-HMMSKEKRDSISKEDLARATLVTITNNIGSIARMCAV 376

  Fly   206 VFVDNSGVDVVLGVLPFVRGLLKRGTKVLLCANSEPALNDVTSEELKSLLDDCSRECEVLEQAWS 270
                |..::.|:.|..|:|                  :|.|:::.|...:|           .||
Zfish   377 ----NEKIERVVFVGNFLR------------------INTVSTKLLAYAMD-----------FWS 408

  Fly   271 KGQL 274
            ||||
Zfish   409 KGQL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5828NP_001260085.1 DUF89 54..347 CDD:280170 45/199 (23%)
pank1aXP_005158562.1 Fumble 80..428 CDD:281610 45/199 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D865329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100565
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R888
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.