DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5828 and Pank3

DIOPT Version :9

Sequence 1:NP_001260085.1 Gene:CG5828 / 33742 FlyBaseID:FBgn0031682 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001101742.1 Gene:Pank3 / 360511 RGDID:1310531 Length:370 Species:Rattus norvegicus


Alignment Length:155 Identity:39/155 - (25%)
Similarity:54/155 - (34%) Gaps:56/155 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 RLQELDALADEDTRWTELVRGVLAGNMFDWGAQAISNILEQDSNFGLHSALDRIEKRPWLLDNLD 190
            :|.|||.          ||:|:|..:...:..||      :...|...|..:|.:|.|:.||   
  Rat   135 KLDELDC----------LVKGLLYIDSVSFNGQA------ECYYFANASEPERCQKMPFNLD--- 180

  Fly   191 SWLNRLKGEPHKCAVVFVDNSGVDVVLGVLPFVRGLLKRGTKVLLCANSEPALNDVTSEELK--- 252
                    :|:...||.: .|||.:                   |..:|:.....||...|.   
  Rat   181 --------DPYPLLVVNI-GSGVSI-------------------LAVHSKDNYKRVTGTSLGGGT 217

  Fly   253 -----SLLDDCSRECEVLEQAWSKG 272
                 |||..|....|.||.| |||
  Rat   218 FLGLCSLLTGCESFEEALEMA-SKG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5828NP_001260085.1 DUF89 54..347 CDD:280170 39/155 (25%)
Pank3NP_001101742.1 Fumble 14..362 CDD:397611 39/155 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5146
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D865329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100565
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.