DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5828 and Pank2

DIOPT Version :9

Sequence 1:NP_001260085.1 Gene:CG5828 / 33742 FlyBaseID:FBgn0031682 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_038960511.1 Gene:Pank2 / 296167 RGDID:1305169 Length:482 Species:Rattus norvegicus


Alignment Length:171 Identity:34/171 - (19%)
Similarity:59/171 - (34%) Gaps:47/171 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 EDTRWTELVRGVLAGN-----MFDWGAQAISNILEQDSNFGLHSALDRIE---KRPWLLDNLDSW 192
            :.|:..:|||.:..|:     :..|...:.|.:.....:||...:.::.|   |.......|.:.
  Rat   345 DSTKVDKLVRDIYGGDYERFGLPGWAVASSSEMSFFHHSFGNMMSKEKREAASKEDLARATLITI 409

  Fly   193 LNRLKGEPHKCAVVFVDNSGVDVVLGVLPFVRGLLKRGTKVLLCANSEPALNDVTSEELKSLLDD 257
            .|.:......||:    |..::.|:.|..|:|                  :|.:....|...|| 
  Rat   410 TNNIGSIARMCAL----NENINQVVFVGNFLR------------------VNTIAMRLLAYALD- 451

  Fly   258 CSRECEVLEQAWSKGQLLVYAN------GQTGPCLDMRTLP 292
                      .||||||....:      |..|..|::..:|
  Rat   452 ----------YWSKGQLKALFSEHEGYFGAVGALLELLKIP 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5828NP_001260085.1 DUF89 54..347 CDD:280170 34/171 (20%)
Pank2XP_038960511.1 Fumble 117..474 CDD:397611 31/161 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5146
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D865329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100565
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.