DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5828 and Pank1

DIOPT Version :9

Sequence 1:NP_001260085.1 Gene:CG5828 / 33742 FlyBaseID:FBgn0031682 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_006231338.1 Gene:Pank1 / 294088 RGDID:1304677 Length:550 Species:Rattus norvegicus


Alignment Length:148 Identity:34/148 - (22%)
Similarity:52/148 - (35%) Gaps:35/148 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 QELDALADED-TRWTELVRGVLAGNMFDWGAQAISNILEQDSNFGLHSALDRIEKRPWLLDNLDS 191
            :.||..|..| |...:||:.:..|:...:|.|. |.:.....|.......:.|.|.......|.:
  Rat   410 EALDMAAKGDSTNVDKLVKDIYGGDYERFGLQG-SAVASSFGNMMSKEKRESISKEDLARATLVT 473

  Fly   192 WLNRLKGEPHKCAVVFVDNSGVDVVLGVLPFVRGLLKRGTKVLLCANSEPALNDVTSEELKSLLD 256
            ..|.:......||:    |..:|.|:.|..|:|                  :|.|:.:.|...:|
  Rat   474 ITNNIGSIARMCAL----NENIDRVVFVGNFLR------------------INMVSMKLLAYAMD 516

  Fly   257 DCSRECEVLEQAWSKGQL 274
                       .||||||
  Rat   517 -----------FWSKGQL 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5828NP_001260085.1 DUF89 54..347 CDD:280170 34/148 (23%)
Pank1XP_006231338.1 Fumble 191..539 CDD:281610 34/148 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5146
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D865329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100565
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.