DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5828 and pank3

DIOPT Version :9

Sequence 1:NP_001260085.1 Gene:CG5828 / 33742 FlyBaseID:FBgn0031682 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001107378.1 Gene:pank3 / 100135204 XenbaseID:XB-GENE-991062 Length:370 Species:Xenopus tropicalis


Alignment Length:143 Identity:35/143 - (24%)
Similarity:54/143 - (37%) Gaps:39/143 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 RLQELDALADEDTRWTELVRGVLAGNMFDWGAQAISNILEQDSNFGLHSALDRIEKRPWLLDNLD 190
            ::.|||.          ||:|:|..:...:..||.....|..|:      .:|.:|.|:.||   
 Frog   135 KVDELDC----------LVKGLLYIDSLSFNGQAECYYFENASH------PERCQKMPFNLD--- 180

  Fly   191 SWLNRLKGEPHKCAVVFVDNSGVDVVLGVLPFVRGLLKRGTKVLLCANSEPALNDVTSEELKSLL 255
                    :|:...||.: .|||.::        .:..:.:...:|..|   |...|...|.|||
 Frog   181 --------DPYPLLVVNI-GSGVSIL--------AVNSKDSYKRVCGTS---LGGGTFLGLCSLL 225

  Fly   256 DDCSRECEVLEQA 268
            ..|....|.||.|
 Frog   226 TGCESFEEALEMA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5828NP_001260085.1 DUF89 54..347 CDD:280170 35/143 (24%)
pank3NP_001107378.1 Fumble 14..362 CDD:367584 35/143 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D865329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R888
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.