DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn11 and RRI1

DIOPT Version :9

Sequence 1:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_010065.2 Gene:RRI1 / 851310 SGDID:S000002375 Length:440 Species:Saccharomyces cerevisiae


Alignment Length:286 Identity:76/286 - (26%)
Similarity:123/286 - (43%) Gaps:71/286 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TDAPVVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVQVIDVFAMPQTGTGVSV 82
            ||.|   :...|.||.|:..|:..:...|..:|:||:::|..:.| .:.|:|.|.:|..||...|
Yeast    63 TDIP---SYTHVLISKLSCEKITHYAVRGGNIEIMGILMGFTLKD-NIVVMDCFNLPVVGTETRV 123

  Fly    83 EAVDPVFQAKMLDMLKQ-----------------TGRPEMVVGWYHSHPGFGCWLSGVDINTQQS 130
            .|     |.:..:.:.|                 .|....||||:|||||:.||||.:||.||..
Yeast   124 NA-----QLESYEYMVQYIDEMYNHNDGGDGRDYKGAKLNVVGWFHSHPGYDCWLSNIDIQTQDL 183

  Fly   131 FEALSERAVAVVVDPIQSVKGKVV-IDAFRLINPNMLVLGQEPRQTTSNLGHLQKPSVQALIHGL 194
            .:...:..||:||||::|::.|:: :.|||.|...     .:....||                 
Yeast   184 NQRFQDPYVAIVVDPLKSLEDKILRMGAFRTIESK-----SDDNSATS----------------- 226

  Fly   195 NRHYYSISINYRKNELEQKML---LNLHKKSWKDGLTLSDYNEHCSINEDTVAEMLDLAKNYNKS 256
               ||.:......:||.:.:.   ||||      .:...|.:|..|:|     .::|..|.|:..
Yeast   227 ---YYELETIIFDSELNRALFETKLNLH------CVIEDDESEQISLN-----RLIDSMKQYSYL 277

  Fly   257 LEDEEKMTPEQLA-----IKNVGKQD 277
            ::.:...|..:||     :.|..|::
Yeast   278 MDSKNVRTRIKLATTSERVSNENKKN 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 75/285 (26%)
RRI1NP_010065.2 MPN_RPN11_CSN5 62..346 CDD:163700 76/286 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.802101 Normalized mean entropy S108
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.