Sequence 1: | NP_608905.1 | Gene: | Rpn11 / 33738 | FlyBaseID: | FBgn0028694 | Length: | 308 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956792.1 | Gene: | stambpa / 797422 | ZFINID: | ZDB-GENE-040426-1551 | Length: | 418 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 47/200 - (23%) |
---|---|---|---|
Similarity: | 87/200 - (43%) | Gaps: | 33/200 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 DRLLRLGGAMPQAAPPTDAPVVDTAEQVYISSLALLKMLKHGRAGV--PMEVMGLMLGEFVDD-Y 63
Fly 64 TVQVIDVFAMPQTGTG---VSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDI 125
Fly 126 NTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINPNMLVLGQEPRQTTSNLG---HLQKPSV 187
Fly 188 QALIH 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rpn11 | NP_608905.1 | MPN_RPN11_CSN5 | 19..284 | CDD:163700 | 41/182 (23%) |
stambpa | NP_956792.1 | USP8_dimer | 13..114 | CDD:286108 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 199..218 | ||||
MPN_AMSH_like | 248..418 | CDD:163697 | 40/175 (23%) | ||
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 | 329..342 | 5/12 (42%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1310 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |