DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn11 and stambpa

DIOPT Version :9

Sequence 1:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_956792.1 Gene:stambpa / 797422 ZFINID:ZDB-GENE-040426-1551 Length:418 Species:Danio rerio


Alignment Length:200 Identity:47/200 - (23%)
Similarity:87/200 - (43%) Gaps:33/200 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DRLLRLGGAMPQAAPPTDAPVVDTAEQVYISSLALLKMLKHGRAGV--PMEVMGLMLGEFVDD-Y 63
            ||.|:  .::|.:|  ..:.:|:...|:::.:....:.||......  .:|..|::.|:.:.: :
Zfish   228 DRSLK--PSVPVSA--GHSALVNGLRQLFVPAELCQRFLKLAETNTARAVETCGILCGKLMKNAF 288

  Fly    64 TVQVIDVFAMPQTGTG---VSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDI 125
            ||..:.|   |:...|   ...|..:.:|       |.|.....:.:||.|:||....:||.||:
Zfish   289 TVTHVIV---PKQCGGPDYCDTENEEELF-------LIQDQNDLITLGWIHTHPTQTAFLSSVDL 343

  Fly   126 NTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINPNMLVLGQEPRQTTSNLG---HLQKPSV 187
            :|..|::.:...::|:|..|..:..|     .|||.:..|..:|     |....|   |.:.|.:
Zfish   344 HTHCSYQMMLPESIAIVCSPKFNETG-----YFRLTDYGMDDVG-----TCKQRGFHPHPKDPPL 398

  Fly   188 QALIH 192
            .|..|
Zfish   399 FAASH 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 41/182 (23%)
stambpaNP_956792.1 USP8_dimer 13..114 CDD:286108
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 199..218
MPN_AMSH_like 248..418 CDD:163697 40/175 (23%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 329..342 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.