Sequence 1: | NP_608905.1 | Gene: | Rpn11 / 33738 | FlyBaseID: | FBgn0028694 | Length: | 308 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005274808.1 | Gene: | BRCC3 / 79184 | HGNCID: | 24185 | Length: | 317 | Species: | Homo sapiens |
Alignment Length: | 228 | Identity: | 64/228 - (28%) |
---|---|---|---|
Similarity: | 89/228 - (39%) | Gaps: | 65/228 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 VVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVQVIDVFAMPQTGTGVSVEAVD 86
Fly 87 PV--------------------------------FQAKMLDMLKQTGRPEMVVGWYHSHPGFGCW 119
Fly 120 LSGVDINTQQSFEALSERAVAVV----VDPIQSVKGKVVIDAFRLINPNMLVLGQEPRQTTSNLG 180
Fly 181 HLQKPSVQALIHGLNRHYYS----ISINYRKNE 209 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rpn11 | NP_608905.1 | MPN_RPN11_CSN5 | 19..284 | CDD:163700 | 64/228 (28%) |
BRCC3 | XP_005274808.1 | MPN_BRCC36 | 13..293 | CDD:163699 | 61/220 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1310 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |