DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn11 and BRCC3

DIOPT Version :9

Sequence 1:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_005274808.1 Gene:BRCC3 / 79184 HGNCID:24185 Length:317 Species:Homo sapiens


Alignment Length:228 Identity:64/228 - (28%)
Similarity:89/228 - (39%) Gaps:65/228 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVQVIDVFAMPQTGTGVSVEAVD 86
            ||...:.|::.|.|.|..|.|..:....|||||.:||..|| |.:....||...|......|.||
Human     5 VVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDD-TSRSDSKFAYTGTEMRTVAEKVD 68

  Fly    87 PV--------------------------------FQAKMLDMLKQTGRPEMVVGWYHSHPGFGCW 119
            .|                                .:|:.|..|  ||||..|||||||||....|
Human    69 AVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAEL--TGRPMRVVGWYHSHPHITVW 131

  Fly   120 LSGVDINTQQSFEALSERAVAVV----VDPIQSVKGKVVIDAFRLINPNMLVLGQEPRQTTSNLG 180
            .|.||:.||..::.:.:..|.::    ::...:..|:|:...|:.|                   
Human   132 PSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSI------------------- 177

  Fly   181 HLQKPSVQALIHGLNRHYYS----ISINYRKNE 209
            ..||.|..  :|| .|.::|    |||..:|.|
Human   178 QAQKSSES--LHG-PRDFWSSSQHISIEGQKEE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 64/228 (28%)
BRCC3XP_005274808.1 MPN_BRCC36 13..293 CDD:163699 61/220 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.