DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn11 and Eif3f

DIOPT Version :9

Sequence 1:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_079620.2 Gene:Eif3f / 66085 MGIID:1913335 Length:361 Species:Mus musculus


Alignment Length:158 Identity:44/158 - (27%)
Similarity:72/158 - (45%) Gaps:36/158 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GGAMPQAAPPTDAPVVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVQVIDVFA 72
            ||.:.:..|...|.:||:.|:           ...|.|    .|:|.:||. ||.::|:|.:.|:
Mouse    92 GGRVVRLHPVILASIVDSYER-----------RNEGAA----RVIGTLLGT-VDKHSVEVTNCFS 140

  Fly    73 MPQTGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQS---FEAL 134
            :|...:...| |||..|...|.::.|:....|:::|||         .:|.|| |:.|   .|..
Mouse   141 VPHNESEDEV-AVDMEFAKNMYELHKKVSPNELILGWY---------ATGHDI-TEHSVLIHEYY 194

  Fly   135 SERA---VAVVVDP-IQSVKGKVVIDAF 158
            |..|   :.:.||. :|  .|::.|.|:
Mouse   195 SREAPNPIHLTVDTGLQ--HGRMSIKAY 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 41/147 (28%)
Eif3fNP_079620.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91
MPN_eIF3f 96..358 CDD:163695 42/154 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.