DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn11 and mpnd

DIOPT Version :9

Sequence 1:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001070033.1 Gene:mpnd / 559169 ZFINID:ZDB-GENE-060929-1162 Length:458 Species:Danio rerio


Alignment Length:104 Identity:30/104 - (28%)
Similarity:46/104 - (44%) Gaps:5/104 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVQVIDVFAMPQTGTGVSVEAVDPVFQAKM 93
            |.:||..||.|..|... ...||:|.:.|.:  |...|::.|.......|.::.:...|..:.::
Zfish   229 VAVSSNVLLLMDFHCHL-TSSEVVGYLGGRW--DTNTQLLTVLRAFPCRTRLADKDAAPAVEEEI 290

  Fly    94 LDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFE 132
            ...|...|.  .:||||||||......|..||::|...:
Zfish   291 CQNLFMRGL--SLVGWYHSHPRGPALPSLQDIDSQMDHQ 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 30/104 (29%)
mpndNP_001070033.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..175
MPN_2A_DUB 223..407 CDD:163698 30/104 (29%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 306..319 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.