DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn11 and brcc3

DIOPT Version :9

Sequence 1:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001016457.1 Gene:brcc3 / 549211 XenbaseID:XB-GENE-5812885 Length:261 Species:Xenopus tropicalis


Alignment Length:153 Identity:41/153 - (26%)
Similarity:66/153 - (43%) Gaps:28/153 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVQVIDVFAM-------------PQTGT 78
            :.|:|...|.|..:.|..:....|||||.:||......|.:..|..:             |:..:
 Frog     4 QAVHIQGDAFLVCVTHSLSTEREEVMGLCIGEVDTQKVVHIHSVIILRRSDKRKDRVEISPEQLS 68

  Fly    79 GVSVEAVDPVFQAKMLDMLKQ-TGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVV 142
            ..:.||          |.|.: ||||..|||||||||....|.|.||:.||..::.:....|.::
 Frog    69 AATTEA----------DRLAEITGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDVGFVGLI 123

  Fly   143 ----VDPIQSVKGKVVIDAFRLI 161
                ::...:..|:::...|:.:
 Frog   124 FSCFIEDKNTKTGRILYTCFQSV 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 41/153 (27%)
brcc3NP_001016457.1 MPN_BRCC36 3..240 CDD:163699 41/153 (27%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 92..105 6/12 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.