DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn11 and cops6

DIOPT Version :9

Sequence 1:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001265456.1 Gene:cops6 / 448375 XenbaseID:XB-GENE-947827 Length:319 Species:Xenopus tropicalis


Alignment Length:221 Identity:53/221 - (23%)
Similarity:81/221 - (36%) Gaps:57/221 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IDVFAMP----QTGTGVSVEAVDPVFQAKMLD----MLKQTGRPEMVVGWYHSHPGFGCWLSGVD 124
            :||.|.|    |..||....|:.|:....:.|    |..|.|||..|:|......      .|.:
 Frog    14 VDVAAFPTVMAQGVTGSVTVALHPLVILNISDHWIRMRSQEGRPVQVIGALIGKQ------EGRN 72

  Fly   125 INTQQSFEALSERAVAVVVDPIQSVKGKVVI---------DAFRLINPNMLVLGQEPRQTTSNLG 180
            |....|||.||           |..:.|:.|         :.|:.:..:|..||.   .||   |
 Frog    73 IEVMNSFELLS-----------QINEEKITINKEYYYTKEEQFKQVFKDMEFLGW---YTT---G 120

  Fly   181 HLQKPSVQALIHGLNRHYYSISINYRKNE-LEQKMLLNLHKKSWKDGLTLSDYNEHCSI-NEDTV 243
            ....||             .|.::.:..| :|..:.|.|:..:....|.:|.|.....| |.:  
 Frog   121 GTPDPS-------------DIHVHKQVCEIIESPLFLKLNPMTKHTDLPVSVYESVIDIVNGE-- 170

  Fly   244 AEMLDLAKNYNKSLEDEEKMTPEQLA 269
            |.||....:|..:.|:.|::..:.:|
 Frog   171 ATMLLAELSYTLATEEAERIGVDHVA 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 53/221 (24%)
cops6NP_001265456.1 MPN_CSN6 31..313 CDD:163694 46/204 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.