DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn11 and CG2224

DIOPT Version :9

Sequence 1:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001263108.1 Gene:CG2224 / 43617 FlyBaseID:FBgn0039773 Length:420 Species:Drosophila melanogaster


Alignment Length:149 Identity:33/149 - (22%)
Similarity:68/149 - (45%) Gaps:14/149 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TDAPVVDTAEQVYISSLALLKMLKHGRAGVP--MEVMGLMLGEFVDDYTVQVIDVFAMPQTGTGV 80
            ||:.:..:...||:....:...||...|...  :|..|::.|. :....:.:..:....|.||  
  Fly   239 TDSLLAGSLRLVYVPGDTMEVFLKLALANTSKNIETCGVLAGH-LSQNQLYITHIITPQQQGT-- 300

  Fly    81 SVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDP 145
             .::.:.:.:.::.|:  |.....:.:||.|:||....:||.||::|..|::.:...|:|:|..|
  Fly   301 -PDSCNTMHEEQIFDV--QDQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVCAP 362

  Fly   146 IQSVKGKVVIDAFRLINPN 164
            ..:..|      |.::.|:
  Fly   363 KYNTTG------FFILTPH 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 32/148 (22%)
CG2224NP_001263108.1 USP8_dimer 16..119 CDD:286108
MPN_AMSH_like 247..419 CDD:163697 31/141 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.