DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn11 and CSN6

DIOPT Version :9

Sequence 1:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_524451.1 Gene:CSN6 / 42661 FlyBaseID:FBgn0028837 Length:341 Species:Drosophila melanogaster


Alignment Length:146 Identity:28/146 - (19%)
Similarity:60/146 - (41%) Gaps:24/146 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PQ----AAPPTDAPVVDTAEQVYISSLALLKMLKH-----GRAGVPMEVMGLMLGEFVDDYTVQV 67
            ||    ||..|...|.     :.:..|.::.:.:|     .:.|.|.:|.|.::|: .....:::
  Fly    38 PQGNIMAAAGTSGSVT-----ISLHPLVIMNISEHWTRFRAQHGEPRQVYGALIGK-QKGRNIEI 96

  Fly    68 IDVFAMPQTGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHS--HPGFGCWLSGVDINTQQS 130
            ::.|.:.....| ....::..:..|.....||.......:|||.:  :|      :..||..|:.
  Fly    97 MNSFELKTDVIG-DETVINKDYYNKKEQQYKQVFSDLDFIGWYTTGDNP------TADDIKIQRQ 154

  Fly   131 FEALSERAVAVVVDPI 146
            ..|::|..:.:.::|:
  Fly   155 IAAINECPIMLQLNPL 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 23/135 (17%)
CSN6NP_524451.1 MPN_CSN6 52..335 CDD:163694 23/132 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.