DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn11 and CG4751

DIOPT Version :9

Sequence 1:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_609495.1 Gene:CG4751 / 34551 FlyBaseID:FBgn0032348 Length:1412 Species:Drosophila melanogaster


Alignment Length:344 Identity:70/344 - (20%)
Similarity:127/344 - (36%) Gaps:89/344 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VYISSLALLKMLKHGRAGVPMEVMGLMLGEF-VDDYTVQVIDVFAMPQTGTGVSVEAVDPV---F 89
            :.::|.|||....|....| .||.|.:.|.: ::.:|:.:...:  |...|....:....|   .
  Fly   284 ITVNSSALLLADFHCHLTV-REVCGYLGGTWDMNTHTLSITKTY--PCRSTRFDRQRAGEVERDI 345

  Fly    90 QAKML-DMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERA--------VAVVVDP 145
            |..|: |.|       ::||||||||.|....:..|.:.|..::.....|        |::::.|
  Fly   346 QKMMIQDQL-------LLVGWYHSHPKFQAEPTLRDCDAQLDYQIKMRGASDLTYTPCVSLIISP 403

  Fly   146 I--QSVKGKVVIDAFRLINPNMLVLGQEPRQTT----------SNLGHLQKP-----SVQALIHG 193
            .  ::...:.|:....::.||      |.||:.          |.|...:.|     .:|..:..
  Fly   404 YYDENPTLESVVKCIWIVPPN------ENRQSMEYGRPMLMQYSVLPDKEIPEEVRSEIQLCVDY 462

  Fly   194 LN---------RHYYSISINYR---KNELEQKMLLNLHKKS-WKDGLTLSDYNEHCSINEDTV-A 244
            .:         |:.|:..:.|.   ||.|..|.......|: |.....:.|    |...:|.: .
  Fly   463 YSQYRSEMVKFRNIYNNDVTYNEKLKNTLYPKFPSKQSDKALWNWICAVLD----CEQEDDFIPP 523

  Fly   245 EMLDLAKNYNKSLEDEE------------KMTP---EQLAIKNVGKQDPKRHLEEKVD------- 287
            :.:.:..|.:..:::|:            |:.|   ||.:....|.:|..|..||:.:       
  Fly   524 KTIKIIDNDDLEVKEEDKPVVLMDLSGDVKINPPKEEQFSEAMGGLEDSGRKAEEESNAQAEQKA 588

  Fly   288 ---KVMQNNIVQCLGAMLD 303
               |||......|:.:.|:
  Fly   589 SELKVMSLQEQLCMPSGLN 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 63/313 (20%)
CG4751NP_609495.1 MPN_2A_DUB 278..463 CDD:163698 42/194 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.