DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn11 and Mysm1

DIOPT Version :9

Sequence 1:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_017175747.1 Gene:Mysm1 / 320713 MGIID:2444584 Length:824 Species:Mus musculus


Alignment Length:276 Identity:74/276 - (26%)
Similarity:118/276 - (42%) Gaps:58/276 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QVYISSLALLKMLKHGRAGVPMEVMGLMLGEF------VDDYTVQVIDVFAMPQTGTGVSVEAVD 86
            ||.:::.|||.|..|....: .||:||:.|.:      :::..:||..........||:..| :|
Mouse   567 QVKVAAEALLIMNLHAHVSM-AEVIGLLGGRYSEADKVLENNLLQVCAAEPCNSLSTGLQCE-MD 629

  Fly    87 PVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKG 151
            ||.|.:..:.|...|  ..|:|||||||.|....|..||:||..:::...|..|..:.       
Mouse   630 PVSQTQASETLALRG--YSVIGWYHSHPAFDPNPSLRDIDTQAKYQSYFSRGGAKFIG------- 685

  Fly   152 KVVIDAFRLINP------NMLVLGQE-PRQTTSNLGH-------LQKPSVQALIHGLNR---HYY 199
             :::..:...||      ..||:.:| ....|..|.:       |::|..: |:....|   ..|
Mouse   686 -MIVSPYNRSNPLPYSQITCLVISEEVSPDGTYRLPYKFEVQQMLEEPQWE-LVFEKTRWIIEKY 748

  Fly   200 SIS--------INYRKNELE--QKMLLNLHKKSWKDGLTLSDYNEHCSINEDTVAEMLDLAKNYN 254
            .:|        |..|.::|.  ||:|..|.|       |||.. .:|.|.|:.:.::.:|..:..
Mouse   749 RLSNSSVPMDRIFRRDSDLTCLQKLLECLRK-------TLSKV-ANCFIAEEFLTQIENLFLSNY 805

  Fly   255 KSLED----EEKMTPE 266
            ||.|:    ||..|.|
Mouse   806 KSKEENGLAEEDSTKE 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 74/276 (27%)
Mysm1XP_017175747.1 Myb_DNA-binding 116..160 CDD:365977
SWIRM 373..452 CDD:367940
MPN_2A_DUB 562..749 CDD:163698 50/194 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.