DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn11 and Cops5

DIOPT Version :9

Sequence 1:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001020866.1 Gene:Cops5 / 312916 RGDID:1310301 Length:334 Species:Rattus norvegicus


Alignment Length:261 Identity:92/261 - (35%)
Similarity:142/261 - (54%) Gaps:38/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVQVIDVFAMPQTG--TGVSVEAVDPVFQAKM 93
            ||:||||||:.|.|:|..:||||||||: ||..|:.::|.||:|..|  |.|:.:|....:.|..
  Rat    57 ISALALLKMVMHARSGGNLEVMGLMLGK-VDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAY 120

  Fly    94 LDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVK-GKVVIDA 157
            ::..||.||.|..:||||||||:||||||:|::||...:...|..||||:||.:::. |||.:.|
  Rat   121 IENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGA 185

  Fly   158 FRLINPNMLVLGQEPRQ-TTSNLGHLQKPSVQALIHGLNRHYYSISINYRKNELEQKMLLNLHKK 221
            ||..........:.|.: .|..|..::...|..      :.||::.::|.|:.|::|:|..|..|
  Rat   186 FRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHC------KQYYALEVSYFKSSLDRKLLELLWNK 244

  Fly   222 SWKDG------LTLSDYNEHCSINEDTVAEMLDLAKNYNKS------------LEDEEKMTPEQL 268
            .|.:.      ||.:||         |..::.||::...:|            ||..::.:.::|
  Rat   245 YWVNTLSSSSLLTNADY---------TTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKL 300

  Fly   269 A 269
            |
  Rat   301 A 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 92/261 (35%)
Cops5NP_001020866.1 MPN_RPN11_CSN5 44..314 CDD:163700 92/261 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031881at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.