DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn11 and Brcc3

DIOPT Version :9

Sequence 1:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001159929.1 Gene:Brcc3 / 210766 MGIID:2389572 Length:291 Species:Mus musculus


Alignment Length:181 Identity:46/181 - (25%)
Similarity:77/181 - (42%) Gaps:50/181 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDY---------------------TV 65
            ||...:.|::.|.|.|..|.|..:....|||||.:||..||.                     |:
Mouse     5 VVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDIRSDSKFTYTGTEMRTVQEKMDTI 69

  Fly    66 QVIDVFAM----------------PQTGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHP 114
            :::.:.::                |:..:..|.||      .::.::   ||||..|||||||||
Mouse    70 RIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEA------ERLAEL---TGRPMRVVGWYHSHP 125

  Fly   115 GFGCWLSGVDINTQQSFEALSERAVAVV----VDPIQSVKGKVVIDAFRLI 161
            ....|.|.||:.||..::.:.:..|.::    ::...:..|:|:...|:.|
Mouse   126 HITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSI 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 46/181 (25%)
Brcc3NP_001159929.1 MPN_BRCC36 13..267 CDD:163699 43/173 (25%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 122..135 6/12 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.