DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn11 and eif-3.F

DIOPT Version :9

Sequence 1:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_495988.1 Gene:eif-3.F / 174478 WormBaseID:WBGene00001229 Length:294 Species:Caenorhabditis elegans


Alignment Length:253 Identity:55/253 - (21%)
Similarity:93/253 - (36%) Gaps:89/253 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 MGLMLGEFVDDYTVQVIDVFAMPQTGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGW------- 109
            ||.::| :.:..::||.:.||:|...:...:| :|..|..:|:..||:|...|..|||       
 Worm    38 MGTLMG-YYEKGSIQVTNCFAIPFNESNDDLE-IDDQFNQQMISALKKTSPNEQPVGWFLTTSDI 100

  Fly   110 ------YHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVD-----------PIQS-------VK 150
                  ||.:        .|.:.|:.|....|...|.:.:|           |:::       :.
 Worm   101 TSSCLIYHDY--------YVRVITEASARRESPPIVVLTIDTTFSGDMSKRMPVRAYLRSKAGIP 157

  Fly   151 G------------KVVIDAFRLINPNMLV--------LGQEPRQTT--SNLGHLQKPSVQALIHG 193
            |            :|.:.||    |..||        |....|:.|  |.|..|:..:.| :|..
 Worm   158 GAAGPHCAIFNPLRVELAAF----PGELVAMQLIEKALDSRRREATLESGLEQLETSTAQ-MIEW 217

  Fly   194 LNR--HYY-SISINYRK------------------NELEQKMLLNLHKKSWKDGLTLS 230
            |.|  ||. .::.|..|                  |.::.:.|..|.|.:.:|.:.:|
 Worm   218 LERMLHYVEDVNKNGEKPGDAQIGRQLMDIVTASSNNMQPEKLDTLVKNTLRDYVMVS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 55/253 (22%)
eif-3.FNP_495988.1 MPN_eIF3f 7..291 CDD:163695 55/253 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.