DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn11 and MYSM1

DIOPT Version :9

Sequence 1:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001078956.1 Gene:MYSM1 / 114803 HGNCID:29401 Length:828 Species:Homo sapiens


Alignment Length:276 Identity:77/276 - (27%)
Similarity:118/276 - (42%) Gaps:59/276 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVD-DYTVQVIDVFAMPQTGTGVSVEAVDPVFQA 91
            ||.::|.|||.|..|....: .||:||:.|.:.: |..|:|..........||:..| :|||.|.
Human   576 QVKVASEALLIMDLHAHVSM-AEVIGLLGGRYSEVDKVVEVCAAEPCNSLSTGLQCE-MDPVSQT 638

  Fly    92 KMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVID 156
            :..:.|...|  ..|:|||||||.|....|..||:||..:::...|..|..:.        :::.
Human   639 QASETLAVRG--FSVIGWYHSHPAFDPNPSLRDIDTQAKYQSYFSRGGAKFIG--------MIVS 693

  Fly   157 AFRLINP------NMLVLGQEPRQTTSNLGHLQKP---SVQALIH----GL---------NRHYY 199
            .:...||      ..||:.:|    .|..|..:.|   .||.::.    ||         .::..
Human   694 PYNRNNPLPYSQITCLVISEE----ISPDGSYRLPYKFEVQQMLEEPQWGLVFEKTRWIIEKYRL 754

  Fly   200 SIS------INYRKNELE--QKMLLNLHKKSWKDGLTLSDYNEHCSINEDTVAEMLDL-AKNYNK 255
            |.|      |..|.::|.  ||:|..:.|       |||... :|.:.|:.:.|:.:| ..||..
Human   755 SHSSVPMDKIFRRDSDLTCLQKLLECMRK-------TLSKVT-NCFMAEEFLTEIENLFLSNYKS 811

  Fly   256 SLED---EEKMTPEQL 268
            :.|:   ||..|.|.|
Human   812 NQENGVTEENCTKELL 827

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 77/276 (28%)
MYSM1NP_001078956.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
SANT 120..164 CDD:197842
Myb_DNA-binding 120..162 CDD:278669
SWIRM 382..461 CDD:282311
MPN_2A_DUB 571..753 CDD:163698 53/192 (28%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 656..669 6/12 (50%)
LXXLL motif 774..778 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.