DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn11 and COPS6

DIOPT Version :9

Sequence 1:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_006824.2 Gene:COPS6 / 10980 HGNCID:21749 Length:327 Species:Homo sapiens


Alignment Length:217 Identity:52/217 - (23%)
Similarity:82/217 - (37%) Gaps:53/217 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 VIDVFAMPQTGTGVSVEAVDPVFQAKMLD----MLKQTGRPEMVVGWYHSHPGFGCWLSGVDINT 127
            |..|.|...||: ||| |:.|:....:.|    |..|.|||..|:|......      .|.:|..
Human    27 VPSVMACGVTGS-VSV-ALHPLVILNISDHWIRMRSQEGRPVQVIGALIGKQ------EGRNIEV 83

  Fly   128 QQSFEALSERAVAVVVDPIQSVKGKVVID---------AFRLINPNMLVLGQEPRQTTSNLGHLQ 183
            ..|||.||           .:|:.|::||         .|:.:...:..||.   .||..     
Human    84 MNSFELLS-----------HTVEEKIIIDKEYYYTKEEQFKQVFKELEFLGW---YTTGG----- 129

  Fly   184 KPSVQALIHGLNRHYYSISINYRKNELEQKMLLNLHKKSWKDGLTLSDYNEHCS-INEDTVAEML 247
             |...:.|| :::....|        :|..:.|.|:..:....|.:|.:..... ||.:  |.||
Human   130 -PPDPSDIH-VHKQVCEI--------IESPLFLKLNPMTKHTDLPVSVFESVIDIINGE--ATML 182

  Fly   248 DLAKNYNKSLEDEEKMTPEQLA 269
            .....|..:.|:.|::..:.:|
Human   183 FAELTYTLATEEAERIGVDHVA 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 52/217 (24%)
COPS6NP_006824.2 MPN_CSN6 39..321 CDD:163694 47/204 (23%)
Interaction with Vpr 211..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.