DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpn11 and STAMBP

DIOPT Version :9

Sequence 1:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001340896.1 Gene:STAMBP / 10617 HGNCID:16950 Length:424 Species:Homo sapiens


Alignment Length:151 Identity:35/151 - (23%)
Similarity:69/151 - (45%) Gaps:20/151 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDRLLRLGGAMPQAAPPTDAPVVDTAEQVYISSLALLKMLKHGRAGVP--MEVMGLMLGEFV-DD 62
            :||.|:.|......:.||    :|....|.:......:.|:...|...  :|..|::.|:.: ::
Human   233 VDRSLKPGALSNSESIPT----IDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNE 293

  Fly    63 YTVQVIDVFAMPQTGTG---VSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVD 124
            :|:..:   .:|:...|   .:.|..:.:|       |.|..:..:.:||.|:||....:||.||
Human   294 FTITHV---LIPKQSAGSDYCNTENEEELF-------LIQDQQGLITLGWIHTHPTQTAFLSSVD 348

  Fly   125 INTQQSFEALSERAVAVVVDP 145
            ::|..|::.:...:||:|..|
Human   349 LHTHCSYQMMLPESVAIVCSP 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 29/133 (22%)
STAMBPNP_001340896.1 Interaction with CHMP3 1..127
USP8_dimer 7..114 CDD:312504
Interaction with STAM 227..231
MPN_AMSH_like 254..424 CDD:163697 28/126 (22%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 335..348 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.