DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3.3A and AT5G12910

DIOPT Version :9

Sequence 1:NP_001260082.1 Gene:His3.3A / 33736 FlyBaseID:FBgn0014857 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_196795.1 Gene:AT5G12910 / 831131 AraportID:AT5G12910 Length:131 Species:Arabidopsis thaliana


Alignment Length:135 Identity:93/135 - (68%)
Similarity:115/135 - (85%) Gaps:5/135 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||:.|||||:||||||  ..|.:..:.|.|.   :|||:||:||||||||||:|||:|:|:|||
plant     1 MARSNQTARKATGGKAP--HFAMRVWQHSTPP---LKKPYRYKPGTVALREIRKYQKTTDLVIRK 60

  Fly    66 LPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            |||||||:||||..|.|||||:.|:.|||||:||::||:||||||||:||||.||||||||||:|
plant    61 LPFQRLVKEIAQSLKADLRFQTGAVSALQEAAEAFMVGMFEDTNLCAMHAKRSTIMPKDIQLAKR 125

  Fly   131 IRGER 135
            :||:|
plant   126 LRGDR 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3.3ANP_001260082.1 PTZ00018 1..136 CDD:185400 93/135 (69%)
AT5G12910NP_196795.1 H4 1..130 CDD:419976 92/133 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54047
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.