DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3.3A and h3-3a

DIOPT Version :9

Sequence 1:NP_001260082.1 Gene:His3.3A / 33736 FlyBaseID:FBgn0014857 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001005101.1 Gene:h3-3a / 448680 XenbaseID:XB-GENE-6042439 Length:136 Species:Xenopus tropicalis


Alignment Length:136 Identity:136/136 - (100%)
Similarity:136/136 - (100%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 Frog    66 LPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130

  Fly   131 IRGERA 136
            ||||||
 Frog   131 IRGERA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3.3ANP_001260082.1 PTZ00018 1..136 CDD:185400 134/134 (100%)
h3-3aNP_001005101.1 PTZ00018 1..136 CDD:185400 134/134 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 257 1.000 Domainoid score I1980
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H133876
Inparanoid 1 1.050 265 1.000 Inparanoid score I2977
OMA 1 1.010 - - QHG54047
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 1 1.000 - - oto104528
Panther 1 1.100 - - LDO PTHR11426
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X183
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.