DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3.3A and His3:CG33839

DIOPT Version :9

Sequence 1:NP_001260082.1 Gene:His3.3A / 33736 FlyBaseID:FBgn0014857 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001027343.1 Gene:His3:CG33839 / 3772032 FlyBaseID:FBgn0053839 Length:136 Species:Drosophila melanogaster


Alignment Length:136 Identity:132/136 - (97%)
Similarity:135/136 - (99%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||||||||||||||||||||||||||||||:|||||||||||||||||||||||||||||||||
  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            ||||||||||||||||||||||:|:.|||||||||||||||||||||||||||||||||||||||
  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130

  Fly   131 IRGERA 136
            ||||||
  Fly   131 IRGERA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3.3ANP_001260082.1 PTZ00018 1..136 CDD:185400 130/134 (97%)
His3:CG33839NP_001027343.1 PTZ00018 1..136 CDD:185400 130/134 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458835
Domainoid 1 1.000 242 1.000 Domainoid score I445
eggNOG 1 0.900 - - E2759_KOG1745
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 249 1.000 Inparanoid score I791
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54047
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 1 1.000 - - otm46875
orthoMCL 1 0.900 - - OOG6_100119
Panther 1 1.100 - - P PTHR11426
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X183
1110.800

Return to query results.
Submit another query.