DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3.3A and LOC103691547

DIOPT Version :9

Sequence 1:NP_001260082.1 Gene:His3.3A / 33736 FlyBaseID:FBgn0014857 Length:136 Species:Drosophila melanogaster
Sequence 2:XP_008759202.1 Gene:LOC103691547 / 103691547 RGDID:9191676 Length:130 Species:Rattus norvegicus


Alignment Length:137 Identity:80/137 - (58%)
Similarity:89/137 - (64%) Gaps:8/137 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |..|||.|.|||||.||||:|||.||.||.||:||||.||..||||||..|||.|||.|||||.:
  Rat     1 MTPTKQIAHKSTGGTAPRKKLATNAACKSMPSSGGVKTPHHSRPGTVAPYEIRSYQKFTELLICR 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFE-DTNLCAIHAKRVTIMPKDIQLAR 129
            .|.|.||:||:|||||:|...|..|..|:|||.|||..||. ....|..:|||       |.||.
  Rat    66 FPVQHLVQEISQDFKTNLCLHSTVISPLKEASGAYLGDLFAIPCQTCNNYAKR-------IHLAC 123

  Fly   130 RIRGERA 136
            .|.|:||
  Rat   124 YIHGKRA 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3.3ANP_001260082.1 PTZ00018 1..136 CDD:185400 78/135 (58%)
LOC103691547XP_008759202.1 H4 1..130 CDD:304892 78/135 (58%)
Histone 1..125 CDD:278551 76/130 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.