DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14036 and Gtsf1

DIOPT Version :9

Sequence 1:NP_608903.1 Gene:CG14036 / 33735 FlyBaseID:FBgn0031677 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_083073.1 Gene:Gtsf1 / 74174 MGIID:1921424 Length:167 Species:Mus musculus


Alignment Length:103 Identity:35/103 - (33%)
Similarity:48/103 - (46%) Gaps:18/103 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CPYDKSHRILLFRMPKHLIKCEKNY--CGPPLQTCKYNATHRV--QDMEKHLKECD---YYLRSI 66
            |||||:|:|...|.|.|||||.||:  ....|.||.:||.|:|  .::..|:..||   ...:.:
Mouse    17 CPYDKNHQIRACRFPYHLIKCRKNHPDVANKLATCPFNARHQVPRAEISHHISSCDDKSCIEQDV 81

  Fly    67 ENQAVQIALRS------RIPPKQED-----GHDVDTPF 93
            .||...:...:      :.||..||     .....|||
Mouse    82 VNQTRNLGQETLAESTWQCPPCDEDWDKDLWEQTSTPF 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14036NP_608903.1 zf-U11-48K 8..30 CDD:283028 13/20 (65%)
zf-U11-48K 40..59 CDD:283028 7/20 (35%)
Gtsf1NP_083073.1 zf-U11-48K 15..38 CDD:398771 13/20 (65%)
zf-U11-48K 49..71 CDD:398771 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4376
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359124at2759
OrthoFinder 1 1.000 - - FOG0006211
OrthoInspector 1 1.000 - - otm42358
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5535
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.