DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14036 and Gtsf1l

DIOPT Version :9

Sequence 1:NP_608903.1 Gene:CG14036 / 33735 FlyBaseID:FBgn0031677 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_080906.1 Gene:Gtsf1l / 68236 MGIID:1915486 Length:151 Species:Mus musculus


Alignment Length:85 Identity:28/85 - (32%)
Similarity:41/85 - (48%) Gaps:10/85 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ICPYDKSHRILLFRMPKHLIKCEKNYCGP----PLQTCKYNATH--RVQDMEKHLKECDYYLRSI 66
            ||||:..|||.|.|...||..|.|.  .|    .:.:|||||.|  .::.:.:|...| ....|:
Mouse     8 ICPYNPHHRIPLSRFQYHLASCRKK--NPKKAKKMASCKYNACHVVPIRKLAEHEATC-VNRSSV 69

  Fly    67 ENQAVQIALRSRIP-PKQED 85
            |.:.....|:..:| |:.:|
Mouse    70 EEEDTLGPLQVSLPQPQNQD 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14036NP_608903.1 zf-U11-48K 8..30 CDD:283028 11/21 (52%)
zf-U11-48K 40..59 CDD:283028 7/20 (35%)
Gtsf1lNP_080906.1 zf-U11-48K 8..30 CDD:283028 11/21 (52%)
zf-U11-48K 41..63 CDD:283028 7/21 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 130..151
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4376
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X10473
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.