DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14036 and zgc:56699

DIOPT Version :9

Sequence 1:NP_608903.1 Gene:CG14036 / 33735 FlyBaseID:FBgn0031677 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_997998.1 Gene:zgc:56699 / 405758 ZFINID:ZDB-GENE-040426-2099 Length:182 Species:Danio rerio


Alignment Length:94 Identity:29/94 - (30%)
Similarity:49/94 - (52%) Gaps:11/94 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CPYDKSHRILLFRMPKHLIKCEKNY--CGPPLQTCKYNATHRV--QDMEKHLKEC-DYYLRSIEN 68
            |||||:|:|...|.|.|::||.||:  ....|:||.:||.|.:  .:|..|:..| |....:.|:
Zfish    46 CPYDKNHQIRASRFPFHVLKCRKNHPKLASELKTCPFNARHLIPKHEMSHHIANCEDKRCLNAED 110

  Fly    69 QAVQIALRSRIP------PKQEDGHDVDT 91
            ..|::..:.::|      |...:..:.:|
Zfish   111 GNVEVLEKFQVPVNTWTNPAPNEDWETET 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14036NP_608903.1 zf-U11-48K 8..30 CDD:283028 11/20 (55%)
zf-U11-48K 40..59 CDD:283028 7/20 (35%)
zgc:56699NP_997998.1 zf-U11-48K 44..67 CDD:283028 11/20 (55%)
zf-U11-48K 78..101 CDD:283028 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359124at2759
OrthoFinder 1 1.000 - - FOG0006211
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5535
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.