DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14036 and Gtsf1l

DIOPT Version :9

Sequence 1:NP_608903.1 Gene:CG14036 / 33735 FlyBaseID:FBgn0031677 Length:93 Species:Drosophila melanogaster
Sequence 2:XP_006235686.3 Gene:Gtsf1l / 366244 RGDID:1306224 Length:151 Species:Rattus norvegicus


Alignment Length:85 Identity:29/85 - (34%)
Similarity:41/85 - (48%) Gaps:10/85 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ICPYDKSHRILLFRMPKHLIKCEKNYCGP----PLQTCKYNATH--RVQDMEKHLKECDYYLRSI 66
            ||||:..|||.|.|...||..|.|.  .|    .:.:|||||.|  .::.:.:|...| ....|:
  Rat     8 ICPYNPHHRIPLSRFQYHLASCRKK--NPKKAKKMASCKYNACHVVPIRKLAEHEATC-VNRSSM 69

  Fly    67 ENQAVQIALRSRIP-PKQED 85
            |.:.....|:..:| |:.||
  Rat    70 EEEDALGPLQVSLPRPQNED 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14036NP_608903.1 zf-U11-48K 8..30 CDD:283028 11/21 (52%)
zf-U11-48K 40..59 CDD:283028 7/20 (35%)
Gtsf1lXP_006235686.3 zf-U11-48K 8..30 CDD:398771 11/21 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359124at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.